Gene/Proteome Database (LMPD)
Proteins
| lathosterol oxidase | |
|---|---|
| Refseq ID | NP_001004630 |
| Protein GI | 52219112 |
| UniProt ID | Q66ID6 |
| mRNA ID | NM_001004630 |
| Length | 300 |
| RefSeq Status | PROVISIONAL |
| MDLVLKVADHYFFTPYVYPSSWPEDNPLRQIIGLMVVTNLGAAILYLGLGALSYFFVFDHKLKDHPQFLENQVQREIKYALWSLPWISIPTVALFFAEVRGYSKLYDRVDDSPLGWSGLIFSMVSFLFFTDMCIYWIHRFLHHKLIYKYFHKPHHVWKIPTPFASHAFHPVDGFLQGLPYHIYPFFFPLHKVLYLILYVFVNIWTISIHDGDYRVPNMVEEIINGSAHHTDHHLFFDYNYGQYFTLWDRIGGSYRYPSALMGKGPHDQIKKLMAEGKLISNSSKGHTNNNQKNGIHVKKE | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005506 | IEA:InterPro | F | iron ion binding |
| GO:0016491 | IEA:InterPro | F | oxidoreductase activity |
| GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
| GO:0001878 | IDA:ZFIN | P | response to yeast |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR006694 | Fatty_acid_hydroxylase |
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP011862 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 52219112 | RefSeq | NP_001004630 | 300 | lathosterol oxidase |
Identical Sequences to LMP011862 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:52219112 | GenBank | AAH81395.1 | 300 | Sterol-C5-desaturase (fungal ERG3, delta-5-desaturase) homolog (S. cerevisae) [Danio rerio] |
Related Sequences to LMP011862 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:52219112 | RefSeq | XP_003453777.1 | 302 | PREDICTED: lathosterol oxidase-like [Oreochromis niloticus] |
| GI:52219112 | RefSeq | XP_005916134.1 | 302 | PREDICTED: lathosterol oxidase-like [Haplochromis burtoni] |
| GI:52219112 | RefSeq | XP_007235701.1 | 297 | PREDICTED: lathosterol oxidase-like isoform X1 [Astyanax mexicanus] |
| GI:52219112 | RefSeq | XP_007235702.1 | 297 | PREDICTED: lathosterol oxidase-like isoform X2 [Astyanax mexicanus] |
| GI:52219112 | RefSeq | XP_008331290.1 | 353 | PREDICTED: lathosterol oxidase isoform X1 [Cynoglossus semilaevis] |
| GI:52219112 | RefSeq | XP_008331291.1 | 294 | PREDICTED: lathosterol oxidase isoform X2 [Cynoglossus semilaevis] |