Gene/Proteome Database (LMPD)
Proteins
ORM1-like protein 3 | |
---|---|
Refseq ID | NP_001006087 |
Protein GI | 54400676 |
UniProt ID | Q5XJR6 |
mRNA ID | NM_001006087 |
Length | 153 |
RefSeq Status | PROVISIONAL |
MNVGTAHSEVNPNTRVMNSRGIWLSYVLGIGLLHIILLSIPFVSVPVVWTLTNLIHNMCMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIILYFLTSFYTKYDRVHFVINTISLLTVLIPKLPQFHGVRLFGINKY |
Gene Information
Entrez Gene ID
Gene Name
ORMDL sphingolipid biosynthesis regulator 3
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0035339 | ISS:UniProtKB | C | SPOTS complex |
GO:0005783 | ISS:UniProtKB | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0006672 | ISS:UniProtKB | P | ceramide metabolic process |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR007203 | ORMDL family |
UniProt Annotations
Entry Information
Gene Name
ORMDL sphingolipid biosynthesis regulator 3
Protein Entry
ORML3_DANRE
UniProt ID
Species
Zebrafish
Comments
Comment Type | Description |
---|---|
Function | Negative regulator of sphingolipid synthesis. {ECO:0000250}. |
Similarity | Belongs to the ORM family. {ECO:0000305}. |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011887 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
54400676 | RefSeq | NP_001006087 | 153 | ORM1-like protein 3 |
Identical Sequences to LMP011887 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:54400676 | GenBank | AAH83232.1 | 153 | Zgc:101654 [Danio rerio] |
GI:54400676 | SwissProt | Q5XJR6.1 | 153 | RecName: Full=ORM1-like protein 3 [Danio rerio] |
Related Sequences to LMP011887 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:54400676 | GenBank | AHH40798.1 | 153 | ORM1-like protein 3 [Ictalurus punctatus] |
GI:54400676 | GenBank | KFP19112.1 | 153 | ORM1-like 3 [Egretta garzetta] |
GI:54400676 | RefSeq | XP_005794794.1 | 153 | PREDICTED: ORM1-like protein 3-like [Xiphophorus maculatus] |
GI:54400676 | RefSeq | XP_006638294.1 | 153 | PREDICTED: ORM1-like protein 3-like [Lepisosteus oculatus] |
GI:54400676 | RefSeq | XP_007572317.1 | 153 | PREDICTED: ORM1-like protein 3 [Poecilia formosa] |
GI:54400676 | RefSeq | XP_008435621.1 | 153 | PREDICTED: ORM1-like protein 3 [Poecilia reticulata] |