Gene/Proteome Database (LMPD)
Proteins
| lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial | |
|---|---|
| Refseq ID | NP_001013533 |
| Protein GI | 61806604 |
| UniProt ID | Q5BKV3 |
| mRNA ID | NM_001013515 |
| Length | 493 |
| RefSeq Status | PROVISIONAL |
| MAAVITVRAPFVFMRRLVSARLHRNCCSKLPAACLVLRPHSYSLVAGRQHRYFHTSYVAARPIVQFKLSDIGEGIMEVTVKEWYVKEGDKVSQFDSICEVQSDKASVTITSRYDGVIRKLYYDVDSIALVGKPLVDIETDGGQAESPQEDVVETPAVSQEEHSPQEIKGHKTQATPAVRRLAMENNIKLSEVVGTGKDGRILKEDILNFIAKQTGAILPPAPFQEIRPQPPAAAAPLTPSAKATPPSVPIPVIPKPVFTGKDHTEPIKGFQKAMVKTMSAALKIPHFGYKDEVDLSQLVRLRSELKGLTESRGVKLSYMPFFIKAASLALLHFPILNSSLDENCTSITYKAAHNIGLAMDTSQGLLVPNVKNIQMLSVFEIAVELNRLQILGASGQLGTSDLTGGTFTLSNIGSIGGTYAKPVILPPEVAIGALGKIQVLPRFNHKDEVVKAHIMNVSWSADHRIIDGATMCRFSNLWRSYLENPASMVLDLK | |
Gene Information
Entrez Gene ID
Gene Name
dihydrolipoamide branched chain transacylase E2
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016746 | IEA:UniProtKB-KW | F | transferase activity, transferring acyl groups |
| GO:0009081 | IMP:ZFIN | P | branched-chain amino acid metabolic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001078 | 2-oxoacid dehydrogenase acyltransferase, catalytic domain |
| IPR003016 | 2-oxo acid dehydrogenase, lipoyl-binding site |
| IPR000089 | Biotin/lipoyl attachment |
| IPR023213 | Chloramphenicol acetyltransferase-like domain |
| IPR004167 | E3-binding domain |
| IPR015761 | Lipoamide Acyltransferase |
| IPR011053 | Single hybrid motif |
UniProt Annotations
Entry Information
Gene Name
dihydrolipoamide branched chain transacylase E2
Protein Entry
Q5BKV3_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Similarity | Belongs to the 2-oxoacid dehydrogenase family. |
| Similarity | Contains 1 lipoyl-binding domain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011927 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 61806604 | RefSeq | NP_001013533 | 493 | lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial |
Identical Sequences to LMP011927 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:61806604 | GenBank | AAH90917.1 | 493 | Dihydrolipoamide branched chain transacylase E2 [Danio rerio] |
| GI:61806604 | GenBank | AAI65614.1 | 493 | Dihydrolipoamide branched chain transacylase E2 [Danio rerio] |
Related Sequences to LMP011927 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:61806604 | DBBJ | BAB82382.2 | 495 | branched-chain alpha-keto acid lipoamide acyltransferase [Oncorhynchus mykiss] |
| GI:61806604 | EMBL | CDQ69639.1 | 495 | unnamed protein product [Oncorhynchus mykiss] |
| GI:61806604 | EMBL | CDQ64991.1 | 495 | unnamed protein product [Oncorhynchus mykiss] |
| GI:61806604 | RefSeq | NP_001117675.1 | 495 | branched-chain alpha-keto acid lipoamide acyltransferase [Oncorhynchus mykiss] |
| GI:61806604 | RefSeq | XP_006643150.1 | 480 | PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial-like [Lepisosteus oculatus] |
| GI:61806604 | RefSeq | XP_007240165.1 | 494 | PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial [Astyanax mexicanus] |