Gene/Proteome Database (LMPD)
Proteins
| nuclear envelope phosphatase-regulatory subunit 1 | |
|---|---|
| Refseq ID | NP_001017874 |
| Protein GI | 62955725 |
| UniProt ID | Q561X0 |
| mRNA ID | NM_001017874 |
| Length | 125 |
| RefSeq Status | PROVISIONAL |
| MNSLEQAEDLKAFERRLTEYVSCLQPATGRWRMILIVVSVCTATGAWNWLIDPDTQKVSFFSSLWNHPFFTISCVTLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKPRPHIQ | |
Gene Information
Entrez Gene ID
Gene Name
CTD nuclear envelope phosphatase 1 regulatory subunit 1
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0071595 | ISS:UniProtKB | C | Nem1-Spo7 phosphatase complex |
| GO:0005737 | ISS:UniProtKB | C | cytoplasm |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0031965 | ISS:UniProtKB | C | nuclear membrane |
| GO:0006629 | IEA:UniProtKB-KW | P | lipid metabolic process |
| GO:0035307 | ISS:UniProtKB | P | positive regulation of protein dephosphorylation |
| GO:0010867 | ISS:UniProtKB | P | positive regulation of triglyceride biosynthetic process |
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR019168 | Nuclear envelope phosphatase-regulatory subunit 1 |
UniProt Annotations
Entry Information
Gene Name
CTD nuclear envelope phosphatase 1 regulatory subunit 1
Protein Entry
NEPR1_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Function | May form with the serine/threonine protein phosphatase ctdnep1 an active complex dephosphorylating and activating lipins. Lipins are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at differents levels. May indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be required for proper nuclear membrane morphology and/or dynamics. May also indirectly regulate the production of lipid droplets and triacylglycerol (By similarity). {ECO:0000250}. |
| Similarity | Belongs to the CNEP1R1 family. {ECO:0000305}. |
| Subcellular Location | Nucleus membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Cytoplasm {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011959 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 62955725 | RefSeq | NP_001017874 | 125 | nuclear envelope phosphatase-regulatory subunit 1 |
Identical Sequences to LMP011959 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:62955725 | GenBank | AAH92973.1 | 125 | Zgc:110674 [Danio rerio] |
| GI:62955725 | RefSeq | XP_007244908.1 | 125 | PREDICTED: nuclear envelope phosphatase-regulatory subunit 1-like isoform X2 [Astyanax mexicanus] |
| GI:62955725 | SwissProt | Q561X0.1 | 125 | RecName: Full=Nuclear envelope phosphatase-regulatory subunit 1; AltName: Full=Transmembrane protein 188 [Danio rerio] |
Related Sequences to LMP011959 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:62955725 | EMBL | CAJ81789.1 | 125 | novel protein [Xenopus (Silurana) tropicalis] |
| GI:62955725 | EMBL | CDQ86340.1 | 125 | unnamed protein product [Oncorhynchus mykiss] |
| GI:62955725 | EMBL | CDQ79837.1 | 125 | unnamed protein product [Oncorhynchus mykiss] |
| GI:62955725 | GenBank | ACM08471.1 | 125 | Transmembrane protein 188 [Salmo salar] |
| GI:62955725 | GenBank | ADO27909.1 | 125 | transmembrane protein 188 [Ictalurus furcatus] |
| GI:62955725 | RefSeq | XP_007887625.1 | 125 | PREDICTED: nuclear envelope phosphatase-regulatory subunit 1 [Callorhinchus milii] |