Gene/Proteome Database (LMPD)
LMPD ID
LMP011976
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
all-trans retinoic acid-induced differentiation factor
Gene Symbol
Synonyms
apr3; APR-3; si:ch211-101l18.3
Alternate Names
all-trans retinoic acid-induced differentiation factor; apoptosis related protein 3; apoptosis-related protein 3
Chromosome
20
Proteins
all-trans retinoic acid-induced differentiation factor precursor | |
---|---|
Refseq ID | NP_001038238 |
Protein GI | 229576935 |
UniProt ID | A3KNS9 |
mRNA ID | NM_001044773 |
Length | 230 |
RefSeq Status | VALIDATED |
MTANVTVSSMYLFTVLLLLFNVYVNSQDTDAQLCQMCEGTIRHDSPVWSFCITKGYVKGHCCFKNNTSDVDTIIGLDLSNCSISHVEHLYNSSTALIIDLSNNPISNLSDYVFQGFSQLTQLLLPSKLECPGGRASWEKVEVKSITRICEGQKNACNQTVQMPLVCPENSLCSPYGPGFFECSCLNNFHGYKCMRQGEFPLVKVLGILTASTVVVSSVLWFTQRRKVKNT |
Gene Information
Entrez Gene ID
Gene Name
all-trans retinoic acid-induced differentiation factor
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005635 | ISS:UniProtKB | C | nuclear envelope |
GO:0048471 | ISS:UniProtKB | C | perinuclear region of cytoplasm |
GO:0005886 | IEA:UniProtKB-KW | C | plasma membrane |
GO:0030154 | IEA:UniProtKB-KW | P | cell differentiation |
GO:2000599 | ISS:UniProtKB | P | negative regulation of cyclin catabolic process |
GO:0033689 | ISS:UniProtKB | P | negative regulation of osteoblast proliferation |
GO:0030501 | ISS:UniProtKB | P | positive regulation of bone mineralization |
GO:0045669 | ISS:UniProtKB | P | positive regulation of osteoblast differentiation |
GO:0010468 | ISS:UniProtKB | P | regulation of gene expression |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR013032 | EGF-like, conserved site |
UniProt Annotations
Entry Information
Gene Name
all-trans retinoic acid-induced differentiation factor
Protein Entry
ARAID_DANRE
UniProt ID
Species
Zebrafish
Comments
Comment Type | Description |
---|---|
Function | Involved in osteoblast cell differentiation. May play a role in inducing the cell cycle arrest (By similarity). {ECO:0000250}. |
Sequence Caution | Sequence=AAH95730.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305}; |
Similarity | Contains 1 EGF-like domain. {ECO:0000305}. |
Subcellular Location | Nucleus envelope {ECO:0000250}. Cell membrane {ECO:0000305}; Single-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011976 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
229576935 | RefSeq | NP_001038238 | 230 | all-trans retinoic acid-induced differentiation factor precursor |
Identical Sequences to LMP011976 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:229576935 | SwissProt | A3KNS9.2 | 230 | RecName: Full=All-trans retinoic acid-induced differentiation factor; AltName: Full=Apoptosis-related protein 3; Short=APR-3; Flags: Precursor [Danio rerio] |
Related Sequences to LMP011976 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:229576935 | GenBank | AAH95730.1 | 233 | Si:ch211-101l18.3 protein, partial [Danio rerio] |
GI:229576935 | GenBank | AAI33994.1 | 230 | Si:ch211-101l18.3 protein [Danio rerio] |
GI:229576935 | GenBank | ACI67700.1 | 232 | Apoptosis-related protein 3 precursor [Salmo salar] |
GI:229576935 | GenBank | ACQ58260.1 | 231 | Apoptosis-related protein 3 precursor [Anoplopoma fimbria] |
GI:229576935 | RefSeq | NP_001134481.1 | 232 | Apoptosis-related protein 3 [Salmo salar] |
GI:229576935 | RefSeq | XP_007256710.1 | 241 | PREDICTED: all-trans retinoic acid-induced differentiation factor-like [Astyanax mexicanus] |