Gene/Proteome Database (LMPD)
Proteins
| sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase | |
|---|---|
| Refseq ID | NP_001106903 |
| Protein GI | 164663766 |
| UniProt ID | B0CN48 |
| mRNA ID | NM_001113432 |
| Length | 374 |
| RefSeq Status | PROVISIONAL |
| MVRVVSVLGLVMFSVALLILSLISYVSIKKDFIFTAPKYANAGGPRMYMFHAGFRSQLAMKFLDPAFTSLNTALNENLQESSNWRFNRSAYAELSKEIAQHIDVPHNFTLTKNSVRVGQLMHYDYSSHKYVFSIGENLRSLLPDASPVLNKRYNTCAVVGNSGILTGSRCGPEIDKYDFVFRCNFAPTEVFRRDVGRRTNLTTFNPSILEKYYNNLLTIQDRNNFFLSLKKLDGAILWIPAFFFHTSATVTRTLVDFFVEHKGQLKVQLAWPGNIMQYVNRYWKTKQLSPKRLSTGILMFTLASSLCEQVHLYGFWPFGWDPNTGKELPYHYYDKKGTKFTTKWQESHQLPTEFKLLFKMHADGVLKLSLSHCA | |
Gene Information
Entrez Gene ID
Gene Name
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 3
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030173 | IEA:InterPro | C | integral component of Golgi membrane |
| GO:0008373 | IEA:InterPro | F | sialyltransferase activity |
| GO:0006486 | IEA:InterPro | P | protein glycosylation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 3
Protein Entry
B0CN48_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP011978 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 164663766 | RefSeq | NP_001106903 | 374 | sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase |
Identical Sequences to LMP011978 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:164663766 | GenBank | ABI35987.1 | 374 | alpha-2,8-sialyltransferase ST8Sia III [Danio rerio] |
| GI:164663766 | GenBank | AAI63914.1 | 374 | ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 3 [Danio rerio] |
| GI:164663766 | GenBank | AAI63895.1 | 374 | ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 3 [Danio rerio] |
Related Sequences to LMP011978 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:164663766 | EMBL | CAG29382.1 | 374 | alpha-2,8-sialyltransferase ST8Sia III, partial [Danio rerio] |
| GI:164663766 | EMBL | CDQ82943.1 | 375 | unnamed protein product [Oncorhynchus mykiss] |
| GI:164663766 | GenBank | AHH40132.1 | 375 | Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase [Ictalurus punctatus] |
| GI:164663766 | RefSeq | XP_005944442.1 | 404 | PREDICTED: sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase-like isoform X2 [Haplochromis burtoni] |
| GI:164663766 | RefSeq | XP_007252815.1 | 376 | PREDICTED: sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase isoform X1 [Astyanax mexicanus] |
| GI:164663766 | RefSeq | XP_008294177.1 | 404 | PREDICTED: sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase-like [Stegastes partitus] |