Gene/Proteome Database (LMPD)
Proteins
fatty acid binding protein 11b | |
---|---|
Refseq ID | NP_001018394 |
Protein GI | 66472632 |
UniProt ID | Q503X5 |
mRNA ID | NM_001020558 |
Length | 134 |
RefSeq Status | PROVISIONAL |
MVEQYVGKWKMTSSDNFDEYMKAVGASFASRQMANLAKPSLLIAVDEQGVITMKAVTTFKTLEIKFKLDEEFDETTADDRKVKTTMSLADGKLIQKQTWEGKTTIIEREIQDTKMIAKCTMDDVVAIRTYEKDA |
Gene Information
Entrez Gene ID
Gene Name
fatty acid binding protein 11b
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0008289 | IEA:InterPro | F | lipid binding |
GO:0005215 | IEA:InterPro | F | transporter activity |
GO:0034694 | IDA:ZFIN | P | response to prostaglandin |
GO:0033552 | IDA:ZFIN | P | response to vitamin B3 |
Domain Information
UniProt Annotations
Entry Information
Gene Name
fatty acid binding protein 11b
Protein Entry
Q503X5_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP011981 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
66472632 | RefSeq | NP_001018394 | 134 | fatty acid binding protein 11b |
Identical Sequences to LMP011981 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:66472632 | GenBank | AAH95142.1 | 134 | Fatty acid binding protein 11b [Danio rerio] |
GI:66472632 | GenBank | ABB96216.1 | 134 | adipocyte fatty acid-binding protein [Danio rerio] |
GI:66472632 | GenBank | AAI65498.1 | 134 | Fabp11b protein [Danio rerio] |
Related Sequences to LMP011981 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:66472632 | EMBL | CDQ94209.1 | 133 | unnamed protein product [Oncorhynchus mykiss] |
GI:66472632 | GenBank | ACI68446.1 | 133 | Fatty acid-binding protein, adipocyte [Salmo salar] |
GI:66472632 | GenBank | ACN09888.1 | 133 | Fatty acid-binding protein, adipocyte [Salmo salar] |
GI:66472632 | GenBank | ACN12235.1 | 133 | Fatty acid-binding protein, adipocyte [Salmo salar] |
GI:66472632 | RefSeq | NP_001134675.1 | 133 | Fatty acid-binding protein, adipocyte [Salmo salar] |
GI:66472632 | RefSeq | XP_008275295.1 | 134 | PREDICTED: fatty acid-binding protein, adipocyte-like [Stegastes partitus] |