Gene/Proteome Database (LMPD)
Proteins
annexin A13 | |
---|---|
Refseq ID | NP_001019585 |
Protein GI | 66773118 |
UniProt ID | Q4VBH6 |
mRNA ID | NM_001024414 |
Length | 316 |
RefSeq Status | PROVISIONAL |
MGNVQPTITPFEDFDVVADIKTIRKACKGMGTDEETIISILANRSAAQRLEIKQAYFEKYDDDLEEVLKNELTGNFENAVIAMLDPPNVFMAKELRRAMKGAGTDEDVLVEILCTSTNQDILNCKEAYLQVHERDLEADIEDDTSGEVRNLLVSLLQADRDEAYEVDEALAEQDATSLIEAGEGRFGTDESTFTYILTHRNYLQLQATFKIYETLSGTDILDAIDSEATGTLKDCYVTLVRCAKNPQLYFARRLNAAMKGAGTDEETLIRIIVGRSEVDLETIKDMYLEKYDVTLKDALSSECGGDFKRLLIEILH |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005509 | IEA:InterPro | F | calcium ion binding |
GO:0005544 | IEA:UniProtKB-KW | F | calcium-dependent phospholipid binding |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Domain | A pair of annexin repeats may form one binding site for calcium and phospholipid. |
Similarity | Belongs to the annexin family. |
Similarity | Contains 4 annexin repeats. |
Similarity | Contains annexin repeats. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012001 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
66773118 | RefSeq | NP_001019585 | 316 | annexin A13 |
Identical Sequences to LMP012001 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:66773118 | GenBank | AAH95812.1 | 316 | Zgc:112421 [Danio rerio] |
Related Sequences to LMP012001 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:66773118 | GenBank | AHH39923.1 | 316 | Annexin A13 [Ictalurus punctatus] |
GI:66773118 | RefSeq | XP_003453332.1 | 316 | PREDICTED: annexin A13-like [Oreochromis niloticus] |
GI:66773118 | RefSeq | XP_005171227.1 | 315 | PREDICTED: annexin A13 isoform X1 [Danio rerio] |
GI:66773118 | RefSeq | XP_005804647.1 | 316 | PREDICTED: annexin A13-like [Xiphophorus maculatus] |
GI:66773118 | RefSeq | XP_007250683.1 | 316 | PREDICTED: annexin A13-like [Astyanax mexicanus] |
GI:66773118 | RefSeq | XP_007540267.1 | 316 | PREDICTED: annexin A13-like [Poecilia formosa] |