Gene/Proteome Database (LMPD)
Proteins
| retinoic acid receptor alpha-B | |
|---|---|
| Refseq ID | NP_571474 |
| Protein GI | 110626153 |
| UniProt ID | Q7ZTI3 |
| mRNA ID | NM_131399 |
| Length | 458 |
| RefSeq Status | PROVISIONAL |
| MYESVDVVGLTPSPNPFLSMDYYHQNRGCLIPDKGLVSGAARGFRNPHWSGSNHSVETQSTSSEEIVPSPPSPPPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHREKSCIINKVTRNRCQYCRLQKCLEVGMSKESVRNDRNKRKKDDKKQECLENYVLSPDTEKMIEQVRKAHQETFPSLCQLGKYTTNNSADHRVALDVDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPDQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLLCGDRQDLEQSDKVDELQEPLLEALKIYVRNRRPHKPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLEGGGSKGAGGGGGGGGGKGAPPGSCSPSLSPSSAHSSPSAHSP | |
Gene Information
Entrez Gene ID
Gene Name
retinoic acid receptor, alpha b
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005634 | IEA:UniProtKB-KW | C | nucleus |
| GO:0003708 | IEA:InterPro | F | retinoic acid receptor activity |
| GO:0043565 | IEA:InterPro | F | sequence-specific DNA binding |
| GO:0003707 | IEA:InterPro | F | steroid hormone receptor activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0033339 | IDA:UniProtKB | P | pectoral fin development |
Domain Information
InterPro Annotations
UniProt Annotations
Entry Information
Gene Name
retinoic acid receptor, alpha b
Protein Entry
Q7ZTI3_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Developmental Stage | Expressed both maternally and zygotically. At 9 hpf, expressed in the dorsal epiblast and prospective tail regions, but absent from the ventral epiblast. At 10 hpf, expressed in presumptive diencephalon and hindbrain, in tissue lateral to the head, the posterior neural plate, tail bud and adjacent mesoderm. At 11-15 hpf, restricted expression along the A-P axis of the neural plate up to the rhobomere 1/2 boundary. During somitogenesis, head and tail expression remains. At 18 hpf, retained expression in the neural tube. At 24 hpf, low levels of ubiquitous expression with stronger expression in eyes, hindbrain and spinal cord; in hindbrain the anterior border is at rhombomeres 3-4. Also expressed in non-neural tissues including pharyngeal endoderm, mesenchyme and tail bud. At 48 hpf, expression is maintained in hindbrain, eyes, diencephalon and the pharyngeal region, and is also observed in forebrain, midbrain and pectoral fin bud. {ECO:0000269|PubMed:16455309, ECO:0000269|PubMed:18929555}. |
| Domain | Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain. |
| Function | Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The rar/rxr heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5 (By similarity). Required for hindbrain development and, in lateral plate mesoderm, for specification of the pectoral fins. |
| Induction | Induced by retinoic acid. |
| Similarity | Belongs to the nuclear hormone receptor family. NR1 subfamily. |
| Similarity | Contains 1 nuclear receptor DNA-binding domain. |
| Subcellular Location | Nucleus {ECO:0000255|PROSITE- ProRule:PRU00407}. |
| Subunit | Heterodimer; with an rxr molecule. Binds DNA preferentially as a rar/rxr heterodimer. |
| Tissue Specificity | In the embryo, zygotic expression largely overlaps that of raraa, with high levels in hindbrain, lateral plate mesoderm (LPM) and tail bud, but in later stages rarab is expressed more broadly in the brain, pectoral fin bud and pharyngeal arches. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012010 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 110626153 | RefSeq | NP_571474 | 458 | retinoic acid receptor alpha-B |
Identical Sequences to LMP012010 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:110626153 | GenBank | AAH49301.1 | 458 | Retinoic acid receptor, alpha b [Danio rerio] |
| GI:110626153 | SwissProt | Q7ZTI3.1 | 458 | RecName: Full=Retinoic acid receptor alpha-B; Short=RAR-alpha-B; AltName: Full=Nuclear receptor subfamily 1 group B member 1-B; AltName: Full=Retinoic acid receptor alpha-2.B; Short=RAR-alpha-2.B [Danio rerio] |
Related Sequences to LMP012010 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:110626153 | GenBank | AAA50050.1 | 457 | retinoic acid receptor alpha-2.B [Danio rerio] |
| GI:110626153 | RefSeq | XP_003438797.2 | 455 | PREDICTED: retinoic acid receptor alpha-A-like isoformX1 [Oreochromis niloticus] |
| GI:110626153 | RefSeq | XP_006801062.1 | 455 | PREDICTED: retinoic acid receptor alpha-A-like isoform X1 [Neolamprologus brichardi] |
| GI:110626153 | RefSeq | XP_007234490.1 | 455 | PREDICTED: retinoic acid receptor alpha-B-like isoform X1 [Astyanax mexicanus] |
| GI:110626153 | RefSeq | XP_007559719.1 | 455 | PREDICTED: retinoic acid receptor alpha isoform X1 [Poecilia formosa] |
| GI:110626153 | RefSeq | XP_008288016.1 | 455 | PREDICTED: retinoic acid receptor alpha isoform X1 [Stegastes partitus] |