Gene/Proteome Database (LMPD)
LMPD ID
LMP012040
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
UbiA prenyltransferase domain containing 1
Gene Symbol
Synonyms
wu:fc30e12
Alternate Names
ubiA prenyltransferase domain-containing protein 1; bar; barolo; unm t31131; unm_t31131; protein barolo; protein reddish
Chromosome
8
EC Number
2.5.1.-
Proteins
| ubiA prenyltransferase domain-containing protein 1 | |
|---|---|
| Refseq ID | NP_001186655 |
| Protein GI | 315013548 |
| UniProt ID | E7FB98 |
| mRNA ID | NM_001199726 |
| Length | 336 |
| RefSeq Status | VALIDATED |
| MQEMKPAALSGSNGLNGASGSSVRVPCSRLSRAGRMALDLQSKCAAYVLALRPWSFSASLTPVALGSALAYKLEGSVDLLLLLVCAVAVLLVHGAGNLVNTYYDFSKGIDHKKSDDRTLVDQILKPQDVVMFGAVLYSAGCLCATLLYFLSSLKLEHLALIYFGGLSSSFLYTGGIGLKYVALGDVVILITFGPLAVMFAHAVQVGYLSVLPLVYAVPLALNTEAILHSNNTRDMDSDKQAGIVTLAILLGPTLSYVIYNLLLFVPYLLFCILATRYTISMALPLLTLPMAFPLERQFRCRCYAKIPQKTAKLNLLMGLFYVFGIILAPQGSLPLL | |
Gene Information
Entrez Gene ID
Gene Name
UbiA prenyltransferase domain containing 1
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IDA:ZFIN | C | Golgi apparatus |
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0030173 | IDA:UniProtKB | C | integral component of Golgi membrane |
| GO:0005739 | IEA:UniProtKB-KW | C | mitochondrion |
| GO:0016209 | IMP:UniProtKB | F | antioxidant activity |
| GO:0004517 | IGI:ZFIN | F | nitric-oxide synthase activity |
| GO:0004659 | IDA:UniProtKB | F | prenyltransferase activity |
| GO:0072358 | IMP:UniProtKB | P | cardiovascular system development |
| GO:0071498 | IGI:ZFIN | P | cellular response to fluid shear stress |
| GO:0001885 | IMP:UniProtKB | P | endothelial cell development |
| GO:0009234 | IMP:UniProtKB | P | menaquinone biosynthetic process |
| GO:0055114 | IGI:GOC | P | oxidation-reduction process |
| GO:0006744 | IMP:UniProtKB | P | ubiquinone biosynthetic process |
| GO:0042371 | IMP:UniProtKB | P | vitamin K biosynthetic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
UbiA prenyltransferase domain containing 1
Protein Entry
UBIA1_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Developmental Stage | Ubiquitous expression at 24 hours post fertilization (hpf) in addition to a distinct expression in the heart at 48 hpf. {ECO:0000269|PubMed:23374346}. |
| Disruption Phenotype | Cranial vascular hemorrhages and pericardial edema, leading to complete cardiac and vascular organ failure by 72 hpf. Defects are due to increased oxidative stress. {ECO:0000269|PubMed:23374346, ECO:0000269|PubMed:23533172}. |
| Function | Prenyltransferase that mediates the formation of menaquinone-4 (MK-4) and coenzyme Q10. MK-4 is a vitamin K2 isoform required for endothelial cell development. Mediates the conversion of phylloquinone (PK) into MK-4, probably by cleaving the side chain of phylloquinone (PK) to release 2-methyl-1,4- naphthoquinone (menadione; K3) and then prenylating it with geranylgeranyl pyrophosphate (GGPP) to form MK-4. Also plays a role in cardiovascular development independently of MK-4 biosynthesis, by acting as a coenzyme Q10 biosyntetic enzyme: coenzyme Q10, also named ubiquinone, plays a important antioxidant role in the cardiovascular system. Mediates biosynthesis of coenzyme Q10 in the Golgi membrane, leading to protect cardiovascular tissues from nos3/eNOS-dependent oxidative stress. {ECO:0000269|PubMed:23374346, ECO:0000269|PubMed:23533172}. |
| Pathway | Cofactor biosynthesis; ubiquinone biosynthesis. |
| Pathway | Quinol/quinone metabolism; menaquinone biosynthesis. |
| Similarity | Belongs to the UbiA prenyltransferase family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Golgi apparatus membrane {ECO:0000269|PubMed:23374346}; Multi-pass membrane protein {ECO:0000269|PubMed:23374346}. Mitochondrion {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012040 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 315013548 | RefSeq | NP_001186655 | 336 | ubiA prenyltransferase domain-containing protein 1 |
Identical Sequences to LMP012040 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:315013548 | SwissProt | E7FB98.1 | 336 | RecName: Full=UbiA prenyltransferase domain-containing protein 1; AltName: Full=Protein barolo; AltName: Full=Protein reddish [Danio rerio] |
Related Sequences to LMP012040 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:315013548 | RefSeq | XP_004571037.1 | 350 | PREDICTED: ubiA prenyltransferase domain-containing protein 1-like isoform X2 [Maylandia zebra] |
| GI:315013548 | RefSeq | XP_004571038.1 | 350 | PREDICTED: ubiA prenyltransferase domain-containing protein 1-like isoform X3 [Maylandia zebra] |
| GI:315013548 | RefSeq | XP_005938228.1 | 350 | PREDICTED: ubiA prenyltransferase domain-containing protein 1-like [Haplochromis burtoni] |
| GI:315013548 | RefSeq | XP_007237094.1 | 346 | PREDICTED: ubiA prenyltransferase domain-containing protein 1-like [Astyanax mexicanus] |
| GI:315013548 | RefSeq | XP_007570164.1 | 354 | PREDICTED: ubiA prenyltransferase domain-containing protein 1 [Poecilia formosa] |
| GI:315013548 | RefSeq | XP_007570165.1 | 354 | PREDICTED: ubiA prenyltransferase domain-containing protein 1 [Poecilia formosa] |