Gene/Proteome Database (LMPD)
Proteins
sialidase-1 precursor | |
---|---|
Refseq ID | NP_001038374 |
Protein GI | 113678435 |
UniProt ID | Q1LWP9 |
mRNA ID | NM_001044909 |
Length | 383 |
RefSeq Status | PROVISIONAL |
MDFIRQIGILLGIAVLSSARADKTQIDPLIYEEQLLWVSGGAGQVNAYRIPLLTFTLRGSLLAFSEARKMSSSDIGAKFIALRRSTDRGATWSPTSFIVDDGSLADGLSLGSVVVDEETGAVIIIYSLCFHQYQCSPSSTMMVQSLDDGFTWSVPRNLSIELGVKSFAPGPGFGIQKRYPPSKGRLVVCGHGTIAGDGVFCILSDDHGRSWRYGAALKSIPYNQPKQDLDFNPDECQPVELEDGSIVINVRNQNNYHCRCRIIVRSLDGGESLPVEELVFDKTLIDPVVAAGALQKQGVMYFTNPSSTQHRVNLTLRWSFTDGKSWEKEAVQIWAGPSGYSTMTSLKGGSAEDNKYIFVVYEKGHKDYWETISFAKIHLYGGK |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0004308 | IEA:InterPro | F | exo-alpha-sialidase activity |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP012061 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
113678435 | RefSeq | NP_001038374 | 383 | sialidase-1 precursor |
Identical Sequences to LMP012061 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:113678435 | EMBL | CAK04566.1 | 383 | novel protein similar to vertebrate sialidase 1 (lysosomal sialidase) (NEU1) [Danio rerio] |
GI:113678435 | GenBank | AAI33833.1 | 383 | Neuraminidase 1 [Danio rerio] |
Related Sequences to LMP012061 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:113678435 | DBBJ | BAO47775.1 | 393 | sialidase 1 [Oryzias latipes] |
GI:113678435 | EMBL | CDQ64897.1 | 373 | unnamed protein product [Oncorhynchus mykiss] |
GI:113678435 | GenBank | AHH42613.1 | 382 | Sialidase-1 [Ictalurus punctatus] |
GI:113678435 | RefSeq | NP_001276812.1 | 393 | sialidase 1 (lysosomal sialidase) precursor [Oryzias latipes] |
GI:113678435 | RefSeq | XP_007228594.1 | 380 | PREDICTED: sialidase-1-like [Astyanax mexicanus] |
GI:113678435 | RefSeq | XP_009292495.1 | 314 | PREDICTED: sialidase-1 isoform X1 [Danio rerio] |