Gene/Proteome Database (LMPD)

LMPD ID
LMP012114
Gene ID
565271
Species
Danio rerio (Zebrafish)
Gene Name
G protein-coupled estrogen receptor 1
Gene Symbol
gper1
Synonyms
gper; gpr30
Alternate Names
G-protein coupled estrogen receptor 1; G protein-coupled receptor 30; G-protein coupled receptor 30
Chromosome
3

Proteins

G-protein coupled estrogen receptor 1
Refseq ID NP_001122195
Protein GI 192451481
UniProt ID B3G515
mRNA ID NM_001128723
Length 353
RefSeq Status PROVISIONAL
MEEQTTNVIQIYVNGTEQFNASFDFNITDVKESTDTYEFYIIGLFLSCLYTIFLFPIGFIGNILILVVNLNHRERMTIPDLYFVNLAVADLILVADSLIEVFNLNEKYYDYAVLCTFMSLFLQVNMYSSIFFLTWMSFDRYVALTSSMSSSPLRTMQHAKLSCSLIWMASILATLLPFTIVQTQHTGEVHFCFANVFEIQWLEVTIGFLIPFSIIGLCYSLIVRTLMRAQKHKGLWPRRQKALRMIVVVVLVFFICWLPENVFISIQLLQGTADPSKRTDTTLWHDYPLTGHIVNLAAFSNSCLNPIIYSFLGETFRDKLRLFIKRKASWSVVYRFCNHTLDLQIPVRSESEV

Gene Information

Entrez Gene ID
565271
Gene Name
G protein-coupled estrogen receptor 1
Gene Symbol
gper1
Species
Danio rerio

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030054 IEA:UniProtKB-KW C cell junction
GO:0042995 IEA:UniProtKB-KW C cell projection
GO:0031410 IEA:UniProtKB-KW C cytoplasmic vesicle
GO:0005856 IEA:UniProtKB-KW C cytoskeleton
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0005768 IEA:UniProtKB-KW C endosome
GO:0005794 IEA:UniProtKB-KW C Golgi apparatus
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005739 IEA:UniProtKB-KW C mitochondrion
GO:0005634 IEA:UniProtKB-KW C nucleus
GO:0005886 IDA:ZFIN C plasma membrane
GO:0045211 IEA:UniProtKB-KW C postsynaptic membrane
GO:0030284 IDA:ZFIN F estrogen receptor activity
GO:0004930 IEA:UniProtKB-KW F G-protein coupled receptor activity
GO:0005496 IDA:UniProtKB F steroid binding
GO:0006915 IEA:UniProtKB-KW P apoptotic process
GO:0007420 IDA:UniProtKB P brain development
GO:0007049 IEA:UniProtKB-KW P cell cycle
GO:0030154 IEA:UniProtKB-KW P cell differentiation
GO:0071392 IDA:UniProtKB P cellular response to estradiol stimulus
GO:0051447 IDA:UniProtKB P negative regulation of meiotic cell cycle
GO:0043524 IDA:UniProtKB P negative regulation of neuron apoptotic process
GO:1900194 IDA:UniProtKB P negative regulation of oocyte maturation
GO:0043950 IDA:UniProtKB P positive regulation of cAMP-mediated signaling
GO:0040019 IMP:UniProtKB P positive regulation of embryonic development
GO:2000179 IDA:UniProtKB P positive regulation of neural precursor cell proliferation
GO:0001934 IDA:UniProtKB P positive regulation of protein phosphorylation
GO:0045944 IDA:UniProtKB P positive regulation of transcription from RNA polymerase II promoter
GO:0043401 IDA:GOC P steroid hormone mediated signaling pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
6176487 G alpha (i) signalling events
6175993 GPCR downstream signaling
6176455 Peptide ligand-binding receptors

Domain Information

InterPro Annotations

Accession Description
IPR017452 GPCR, rhodopsin-like, 7TM
IPR000276 G protein-coupled receptor, rhodopsin-like

UniProt Annotations

Entry Information

Gene Name
G protein-coupled estrogen receptor 1
Protein Entry
GPER1_DANRE
UniProt ID
B3G515
Species
Zebrafish

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=2.3 mM for 17-beta-estradiol {ECO:0000269|PubMed:19228597};
Developmental Stage Expressed throughout early embryonic development from 0 hours post-fertilization (hpf) to 72 hpf. Expressed in blastomeres at 4 hpf. Expressed in the central nervous system at 18 hpf. Expressed in head including the anterior diencephalon, midbrain and hindbrain at 24 hpf. Expressed in trigeminal ganglia as well as in the heart, pancreas and intestinal bulb between 36 and 72 hpf (at protein level). {ECO:0000269|PubMed:23583372}.
Disruption Phenotype Morpholino knockdown of the protein leads to growth retardation and developmental deformity. {ECO:0000269|PubMed:23583372}.
Function Membrane G-protein coupled estrogen receptor that binds to 17-beta-estradiol (E2) with high affinity, leading to rapid and transient activation of numerous intracellular signaling pathways. Plays a role in the embryonic development of sensory and motor neurons. Specifically induces apoptosis and reduces proliferation of brain cells. Involved in maintenance of meiotic arrest in oocytes. {ECO:0000269|PubMed:18420744, ECO:0000269|PubMed:19228597, ECO:0000269|PubMed:23583372}.
Similarity Belongs to the G-protein coupled receptor 1 family. {ECO:0000255|PROSITE-ProRule:PRU00521}.
Subcellular Location Nucleus {ECO:0000250}. Cytoplasm, perinuclear region {ECO:0000250}. Cytoplasm {ECO:0000250}. Cytoplasm, cytoskeleton {ECO:0000250}. Cytoplasmic vesicle membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Cell membrane {ECO:0000269|PubMed:19228597}; Multi-pass membrane protein {ECO:0000269|PubMed:19228597}. Basolateral cell membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Early endosome {ECO:0000250}. Recycling endosome {ECO:0000250}. Golgi apparatus, trans-Golgi network {ECO:0000250}. Golgi apparatus membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Cell projection, dendrite {ECO:0000250}. Cell projection, dendritic spine membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Cell projection, axon {ECO:0000250}. Cell junction, synapse, postsynaptic cell membrane, postsynaptic density {ECO:0000250}. Mitochondrion membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Note=Colocalized with cadherin at the plasma membrane. {ECO:0000250}.
Subunit Homodimer. Heterodimer (By similarity). {ECO:0000250}.
Tissue Specificity Expressed in brain regions that are known to control reproduction and sex behavior. Expressed in ovary, muscle and intestine. Expressed in early germ cells of the testis, including the spermatogonia, spermatocytes, and somatic cells such as Sertoli cells. {ECO:0000269|PubMed:19228597}.

Identical and Related Proteins

Unique RefSeq proteins for LMP012114 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
192451481 RefSeq NP_001122195 353 G-protein coupled estrogen receptor 1

Identical Sequences to LMP012114 proteins

Reference Database Accession Length Protein Name
GI:192451481 GenBank ACD88749.1 353 G-protein coupled receptor 30 [Danio rerio]
GI:192451481 RefSeq XP_009298009.1 353 PREDICTED: G-protein coupled estrogen receptor 1 isoform X1 [Danio rerio]
GI:192451481 SwissProt B3G515.1 353 RecName: Full=G-protein coupled estrogen receptor 1; AltName: Full=G protein-coupled estrogen receptor 1; AltName: Full=G-protein coupled receptor 30 [Danio rerio]

Related Sequences to LMP012114 proteins

Reference Database Accession Length Protein Name
GI:192451481 GenBank AGH14250.1 353 G protein-coupled receptor 30 [Paramisgurnus dabryanus]
GI:192451481 RefSeq XP_005468845.1 354 PREDICTED: G-protein coupled estrogen receptor 1-like [Oreochromis niloticus]
GI:192451481 RefSeq XP_005920300.1 354 PREDICTED: G-protein coupled estrogen receptor 1-like [Haplochromis burtoni]
GI:192451481 RefSeq XP_007242598.1 366 PREDICTED: G-protein coupled estrogen receptor 1-like isoform X1 [Astyanax mexicanus]
GI:192451481 RefSeq XP_007242599.1 366 PREDICTED: G-protein coupled estrogen receptor 1-like isoform X2 [Astyanax mexicanus]
GI:192451481 RefSeq XP_008295357.1 354 PREDICTED: G-protein coupled estrogen receptor 1 [Stegastes partitus]