Gene/Proteome Database (LMPD)
Proteins
| diacylglycerol O-acyltransferase 2 | |
|---|---|
| Refseq ID | NP_001025367 |
| Protein GI | 71834534 |
| UniProt ID | Q4V9F0 |
| mRNA ID | NM_001030196 |
| Length | 361 |
| RefSeq Status | PROVISIONAL |
| MKTILAAYSGVKKGSGSSILSALHDLPTVPWLTRSKMVKHLQVISVLQFIMTFLTMGIACSLLLMYMFCTDFWVISVLYVAWLIYDWNTPGQGGRRSTWVRDWTVWKYMRDYFPIRLIKTHNLLPSRNYIFGYHPHGILCFGAFCNFGTEATGFTKVFPGIKPSLATLAGNFRLPMFREYLMCGGICPVNRNSIDYLLSSNGTGNAVVIVIGGAAESLDCAPGRNSVMLKKRKGFVKLALKQGADLVPVYSFGENEVYKQLIFEEGSWWRTIQRKLQKFLGFAPCLFHGCGLFFPESWGLVPYCKPITTVVGEPITVPKIEEPTQDVIDMYHAMYIRSLKSLFDNYKTRFGLNESDTLIIH | |
Gene Information
Entrez Gene ID
Gene Name
diacylglycerol O-acyltransferase 2
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0004144 | IEA:UniProtKB-EC | F | diacylglycerol O-acyltransferase activity |
| GO:0006071 | IEA:UniProtKB-KW | P | glycerol metabolic process |
| GO:0019432 | IEA:UniProtKB-UniPathway | P | triglyceride biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| dre00561 | Glycerolipid metabolism |
| dre01100 | Metabolic pathways |
| dre_M00089 | Triacylglycerol biosynthesis |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 6176789 | Acyl chain remodeling of DAG and TAG |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR007130 | Diacylglycerol acyltransferase |
UniProt Annotations
Entry Information
Gene Name
diacylglycerol O-acyltransferase 2
Protein Entry
DGAT2_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Acyl-CoA + 1,2-diacylglycerol = CoA + triacylglycerol. |
| Function | Essential acyltransferase that catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. Required for synthesis and storage of intracellular triglycerides. Probably plays a central role in cytosolic lipid accumulation (By similarity). {ECO:0000250}. |
| Pathway | Glycerolipid metabolism; triacylglycerol biosynthesis. |
| Similarity | Belongs to the diacylglycerol acyltransferase family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012115 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 71834534 | RefSeq | NP_001025367 | 361 | diacylglycerol O-acyltransferase 2 |
Identical Sequences to LMP012115 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:71834534 | GenBank | AAH96927.1 | 361 | Diacylglycerol O-acyltransferase 2 [Danio rerio] |
| GI:71834534 | SwissProt | Q4V9F0.1 | 361 | RecName: Full=Diacylglycerol O-acyltransferase 2; AltName: Full=Diglyceride acyltransferase 2 [Danio rerio] |
Related Sequences to LMP012115 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:71834534 | GenBank | ADO29420.1 | 361 | diacylglycerol o-acyltransferase 2 [Ictalurus punctatus] |
| GI:71834534 | RefSeq | NP_001188005.1 | 361 | diacylglycerol O-acyltransferase 2 [Ictalurus punctatus] |
| GI:71834534 | RefSeq | XP_004076687.1 | 361 | PREDICTED: diacylglycerol O-acyltransferase 2-like [Oryzias latipes] |
| GI:71834534 | RefSeq | XP_007259505.1 | 361 | PREDICTED: diacylglycerol O-acyltransferase 2 [Astyanax mexicanus] |
| GI:71834534 | RefSeq | XP_008285514.1 | 361 | PREDICTED: diacylglycerol O-acyltransferase 2 [Stegastes partitus] |
| GI:71834534 | RefSeq | XP_008330485.1 | 361 | PREDICTED: diacylglycerol O-acyltransferase 2 [Cynoglossus semilaevis] |