Gene/Proteome Database (LMPD)
Proteins
| dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 | |
|---|---|
| Refseq ID | NP_001093909 |
| Protein GI | 154426290 |
| UniProt ID | A7E2L0 |
| mRNA ID | NM_001100439 |
| Length | 113 |
| RefSeq Status | PROVISIONAL |
| MSNSVFSVISRFVEEYRSSTLTKLKVIDAYLLYILLTGVFQFLYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKGDFLTVSPERAFADFLFAHTVLHLVVVNFVG | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0008250 | IEA:InterPro | C | oligosaccharyltransferase complex |
| GO:0004579 | IEA:InterPro | F | dolichyl-diphosphooligosaccharide-protein glycotransferase activity |
| GO:0006486 | IEA:UniProtKB-UniPathway | P | protein glycosylation |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR003038 | DAD/Ost2 |
UniProt Annotations
Entry Information
Gene Name
defender against cell death 1
Protein Entry
A7E2L0_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Dolichyl diphosphooligosaccharide + [protein]- L-asparagine = dolichyl diphosphate + a glycoprotein with the oligosaccharide chain attached by N-beta-D-glycosyl linkage to a protein L-asparagine. |
| Function | Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. |
| Pathway | Protein modification; protein glycosylation. |
| Similarity | Belongs to the DAD/OST2 family. |
| Subcellular Location | Endoplasmic reticulum membrane ; Multi-pass membrane protein . |
| Subunit | Component of the oligosaccharyltransferase (OST) complex. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012119 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 154426290 | RefSeq | NP_001093909 | 113 | dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 |
Identical Sequences to LMP012119 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:154426290 | GenBank | AAI50400.1 | 113 | Dad1 protein [Danio rerio] |
Related Sequences to LMP012119 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:154426290 | EMBL | CAF97730.1 | 113 | unnamed protein product [Tetraodon nigroviridis] |
| GI:154426290 | GenBank | ACQ58842.1 | 113 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Anoplopoma fimbria] |
| GI:154426290 | RefSeq | XP_003975931.1 | 113 | PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1-like [Takifugu rubripes] |
| GI:154426290 | RefSeq | XP_007233486.1 | 113 | PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1-like [Astyanax mexicanus] |
| GI:154426290 | RefSeq | XP_007242303.1 | 113 | PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad1-like [Astyanax mexicanus] |
| GI:154426290 | RefSeq | XP_008332430.1 | 113 | PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Cynoglossus semilaevis] |