Gene/Proteome Database (LMPD)
Proteins
| platelet-activating factor acetylhydrolase IB subunit beta | |
|---|---|
| Refseq ID | NP_001076320 |
| Protein GI | 130488399 |
| UniProt ID | A2BGB4 |
| mRNA ID | NM_001082851 |
| Length | 228 |
| RefSeq Status | PROVISIONAL |
| MSAEENPAAEPAPVTDVQGDGRWMSQHNRFVQECKDAEPDVLFVGDSMVQLMQQYEVWRELFSPLHALNFGIGGDTTSNVMWRLQNGELENIRPRVVVVWVGTNNHEHTADQVAGGILAIAQLLLSRLPKSKMIVLGLLPRGEFPNPLREKNASVNNLLRASLPRLGPIQFLDMGSSFVHSDGTISSRDMFDYLHLTASAYRTISTTLHELLLQLLEETPQERRASLV | |
Gene Information
Entrez Gene ID
Gene Name
platelet-activating factor acetylhydrolase 1b, catalytic subunit 2
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016787 | IEA:InterPro | F | hydrolase activity |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR013831 | SGNH_hydro-type_esterase_dom |
UniProt Annotations
Entry Information
Gene Name
platelet-activating factor acetylhydrolase 1b, catalytic subunit 2
Protein Entry
A2BGB4_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP012127 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 130488399 | RefSeq | NP_001076320 | 228 | platelet-activating factor acetylhydrolase IB subunit beta |
Identical Sequences to LMP012127 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:130488399 | GenBank | AAI60649.1 | 228 | Si:ch211-139a5.3 [Danio rerio] |
| GI:130488399 | GenBank | AAI63819.1 | 228 | Si:ch211-139a5.3 [Danio rerio] |
| GI:130488399 | GenBank | AAI63859.1 | 228 | Si:ch211-139a5.3 [Danio rerio] |
| GI:130488399 | RefSeq | XP_005165401.1 | 228 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X1 [Danio rerio] |
Related Sequences to LMP012127 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:130488399 | EMBL | CDQ82305.1 | 229 | unnamed protein product [Oncorhynchus mykiss] |
| GI:130488399 | GenBank | AHH42165.1 | 228 | Platelet-activating factor acetylhydrolase IB subunit beta [Ictalurus punctatus] |
| GI:130488399 | RefSeq | XP_006642217.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta-like [Lepisosteus oculatus] |
| GI:130488399 | RefSeq | XP_007261054.1 | 228 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta-like isoform X1 [Astyanax mexicanus] |
| GI:130488399 | RefSeq | XP_007261055.1 | 228 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta-like isoform X2 [Astyanax mexicanus] |
| GI:130488399 | RefSeq | XP_008288172.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta [Stegastes partitus] |