Gene/Proteome Database (LMPD)
Proteins
| serine palmitoyltransferase small subunit B | |
|---|---|
| Refseq ID | NP_001153305 |
| Protein GI | 229577063 |
| UniProt ID | Q1RLT2 |
| mRNA ID | NM_001159833 |
| Length | 80 |
| RefSeq Status | VALIDATED |
| MDMKNMREYMSWLYYQYLLITGIYVLEPWEQSIFNTVLFTMVAMVIYTSYVFVPIHVRLALEFFCELVGGQPESTVALMT | |
Gene Information
Entrez Gene ID
Gene Name
serine palmitoyltransferase, small subunit B
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0017059 | ISS:UniProtKB | C | serine C-palmitoyltransferase complex |
| GO:0006665 | IEA:UniProtKB-UniPathway | P | sphingolipid metabolic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR024512 | Small subunit of serine palmitoyltransferase-like |
UniProt Annotations
Entry Information
Gene Name
serine palmitoyltransferase, small subunit B
Protein Entry
SPTSB_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Function | Stimulates the activity of serine palmitoyltransferase (SPT). The composition of the serine palmitoyltransferase (SPT) complex determines the substrate preference (By similarity). {ECO:0000250}. |
| Pathway | Lipid metabolism; sphingolipid metabolism. |
| Similarity | Belongs to the SPTSS family. SPTSSB subfamily. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
| Subunit | Interacts with sptlc1; the interaction is direct. Component of the serine palmitoyltransferase (SPT) complex (By similarity). {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012192 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 229577063 | RefSeq | NP_001153305 | 80 | serine palmitoyltransferase small subunit B |
Identical Sequences to LMP012192 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:229577063 | GenBank | AAI15299.1 | 80 | Zgc:136867 [Danio rerio] |
| GI:229577063 | RefSeq | NP_001289737.1 | 80 | serine palmitoyltransferase small subunit B [Danio rerio] |
| GI:229577063 | SwissProt | Q1RLT2.1 | 80 | RecName: Full=Serine palmitoyltransferase small subunit B; AltName: Full=Protein ADMP; AltName: Full=Small subunit of serine palmitoyltransferase B; Short=ssSPTb [Danio rerio] |
Related Sequences to LMP012192 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:229577063 | RefSeq | XP_004543635.1 | 125 | PREDICTED: serine palmitoyltransferase small subunit B-like isoform X1 [Maylandia zebra] |
| GI:229577063 | RefSeq | XP_004543636.1 | 125 | PREDICTED: serine palmitoyltransferase small subunit B-like isoform X2 [Maylandia zebra] |
| GI:229577063 | RefSeq | XP_004543638.1 | 80 | PREDICTED: serine palmitoyltransferase small subunit B-like isoform X4 [Maylandia zebra] |
| GI:229577063 | RefSeq | XP_005742207.1 | 80 | PREDICTED: serine palmitoyltransferase small subunit B-like isoform X4 [Pundamilia nyererei] |
| GI:229577063 | RefSeq | XP_005930074.1 | 80 | PREDICTED: serine palmitoyltransferase small subunit B-like isoform X4 [Haplochromis burtoni] |
| GI:229577063 | RefSeq | XP_007258461.1 | 80 | PREDICTED: serine palmitoyltransferase small subunit B [Astyanax mexicanus] |