Gene/Proteome Database (LMPD)
Proteins
inositol 1,4,5-trisphosphate receptor, type 3 | |
---|---|
Refseq ID | NP_001121741 |
Protein GI | 190194228 |
UniProt ID | A8WG42 |
mRNA ID | NM_001128269 |
Length | 226 |
RefSeq Status | PROVISIONAL |
MSDSASSFLHIGDIVSLYAEGTVNGFISTLGLVDDRCVVEPASGDLENPPKKFRDCLFKVYPMNRYSAQKQFWKAKQAKHEKDKIGDMVLLQKLQHAANLEQKQNDAENKKVHGDVVKYGSVIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDGTGNEGSWLFIQPFWKLRANGDNVMQVHTHKLNASTHTLNSHKYEAKIGKLICRKNRLNLRKLHVRNILELF |
Gene Information
Entrez Gene ID
Gene Name
inositol 1,4,5-trisphosphate receptor, type 3
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:InterPro | C | endoplasmic reticulum |
GO:0016020 | IEA:InterPro | C | membrane |
GO:0005220 | IEA:InterPro | F | inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity |
Domain Information
UniProt Annotations
Entry Information
Gene Name
inositol 1,4,5-trisphosphate receptor, type 3
Protein Entry
A8WG42_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP012261 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
190194228 | RefSeq | NP_001121741 | 226 | inositol 1,4,5-trisphosphate receptor, type 3 |
Identical Sequences to LMP012261 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:190194228 | GenBank | AAI54571.1 | 226 | Itpr3 protein [Danio rerio] |
Related Sequences to LMP012261 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:190194228 | GenBank | AHH37387.1 | 2695 | Inositol 1,4,5-trisphosphate receptor type 3 [Ictalurus punctatus] |
GI:190194228 | RefSeq | XP_003963104.1 | 2688 | PREDICTED: inositol 1,4,5-trisphosphate receptor type 3-like [Takifugu rubripes] |
GI:190194228 | RefSeq | XP_004573300.1 | 2685 | PREDICTED: inositol 1,4,5-trisphosphate receptor type 3-like [Maylandia zebra] |
GI:190194228 | RefSeq | XP_005477885.1 | 2691 | PREDICTED: LOW QUALITY PROTEIN: inositol 1,4,5-trisphosphate receptor type 3-like [Oreochromis niloticus] |
GI:190194228 | RefSeq | XP_005748276.1 | 2701 | PREDICTED: LOW QUALITY PROTEIN: inositol 1,4,5-trisphosphate receptor type 3-like [Pundamilia nyererei] |
GI:190194228 | RefSeq | XP_008316204.1 | 2677 | PREDICTED: inositol 1,4,5-trisphosphate receptor type 3 [Cynoglossus semilaevis] |