Gene/Proteome Database (LMPD)

LMPD ID
LMP012273
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
isoprenoid synthase domain containing
Gene Symbol
Synonyms
sb:eu371; zgc:154151
Alternate Names
isoprenoid synthase domain-containing protein; notch1-induced protein; 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase-like protein
Chromosome
15
EC Number
2.7.7.-

Proteins

isoprenoid synthase domain-containing protein
Refseq ID NP_001071270
Protein GI 118150626
UniProt ID A0JPF9
mRNA ID NM_001077802
Length 462
RefSeq Status PROVISIONAL
MGTVTIQLSCLRHIRKLCFSCPWEGRRLFKMLLQFHHETQRPLDPGCLLSQDAERSGDQPGRAVVDFPVAAVLPAGGSGERMGLTTPKQFCSIFNRPLISYTIQAFERLPWIVMVVVVIAKDNHDLMLNIVRKFNHTKVKVVHGGTTRHRSIYNGLQAFSDSTDSSTPKPKVVIIHDAVRPFVEEDLLLKITLAAKEQGASGAIRPLVSTVIATTSESYLDHSLERAKYRASEMPQGFLYDIIFQAYQRCSEFDLEFGTECLHLALQYCGTNARLIEGPPTLWKVTYKRDLAAAEAIIKETLSVSACIIAEAEEEAVELAKTLQKNLNMMETDVIPCGKESNVQYLSKTRNFIHISASASSSSWVLEMVKCFEDIDHARLYPVVIVWVQLSKTKQSADSQETDEFMALASEVKQRNVLLYGIKIDHSKELEQWQRSLERLGQITLVLIRDRNMALTGQMLHV

Gene Information

Entrez Gene ID
Gene Name
isoprenoid synthase domain containing
Gene Symbol
Species
Danio rerio

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016779 IEA:UniProtKB-KW F nucleotidyltransferase activity
GO:0048854 IMP:ZFIN P brain morphogenesis
GO:0008299 IEA:InterPro P isoprenoid biosynthetic process
GO:0048747 IMP:ZFIN P muscle fiber development
GO:0035269 IMP:UniProtKB P protein O-linked mannosylation
GO:0060049 IMP:ZFIN P regulation of protein glycosylation

Domain Information

InterPro Annotations

Accession Description
IPR001228 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
IPR018294 4-diphosphocytidyl-2C-methyl-D-erythritol synthase, conserved site
IPR029044 Nucleotide-diphospho-sugar transferases
IPR012336 Thioredoxin-like fold

UniProt Annotations

Entry Information

Gene Name
isoprenoid synthase domain containing
Protein Entry
ISPD_DANRE
UniProt ID
Species
Zebrafish

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=A0JPF9-1; Sequence=Displayed; Name=2; IsoId=A0JPF9-2; Sequence=VSP_044045; Name=3; IsoId=A0JPF9-3; Sequence=VSP_044046; Note=No experimental confirmation available.;
Disruption Phenotype Hydrocephalus and incomplete brain folding by 48 hours post fertilization (h.p.f.), as well as significantly reduced eye size reminiscent of microphthalmia in patients suffering of muscular dystrophy-dystroglycanopathy congenital with brain and eye anomalies in human. {ECO:0000269|PubMed:22522421}.
Function Required for protein O-linked mannosylation. Probably acts as a nucleotidyltransferase involved in synthesis of a nucleotide sugar. Required for dystroglycan O-mannosylation. {ECO:0000269|PubMed:22522421}.
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the IspD family. {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP012273 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
118150626 RefSeq NP_001071270 462 isoprenoid synthase domain-containing protein

Identical Sequences to LMP012273 proteins

Reference Database Accession Length Protein Name
GI:118150626 GenBank AAI27406.1 462 Zgc:154151 [Danio rerio]

Related Sequences to LMP012273 proteins

Reference Database Accession Length Protein Name
GI:118150626 RefSeq XP_005157821.1 448 PREDICTED: isoprenoid synthase domain-containing protein isoform X1 [Danio rerio]
GI:118150626 RefSeq XP_003450340.2 433 PREDICTED: isoprenoid synthase domain-containing protein-like isoform X1 [Oreochromis niloticus]
GI:118150626 RefSeq XP_005739306.1 433 PREDICTED: isoprenoid synthase domain-containing protein-like [Pundamilia nyererei]
GI:118150626 RefSeq XP_007232398.1 437 PREDICTED: isoprenoid synthase domain-containing protein [Astyanax mexicanus]
GI:118150626 RefSeq XP_009290082.1 275 PREDICTED: isoprenoid synthase domain-containing protein isoform X2 [Danio rerio]
GI:118150626 SwissProt A0JPF9.2 462 RecName: Full=Isoprenoid synthase domain-containing protein; AltName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase-like protein [Danio rerio]