Gene/Proteome Database (LMPD)
LMPD ID
LMP012273
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
isoprenoid synthase domain containing
Gene Symbol
Synonyms
sb:eu371; zgc:154151
Alternate Names
isoprenoid synthase domain-containing protein; notch1-induced protein; 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase-like protein
Chromosome
15
EC Number
2.7.7.-
Proteins
isoprenoid synthase domain-containing protein | |
---|---|
Refseq ID | NP_001071270 |
Protein GI | 118150626 |
UniProt ID | A0JPF9 |
mRNA ID | NM_001077802 |
Length | 462 |
RefSeq Status | PROVISIONAL |
MGTVTIQLSCLRHIRKLCFSCPWEGRRLFKMLLQFHHETQRPLDPGCLLSQDAERSGDQPGRAVVDFPVAAVLPAGGSGERMGLTTPKQFCSIFNRPLISYTIQAFERLPWIVMVVVVIAKDNHDLMLNIVRKFNHTKVKVVHGGTTRHRSIYNGLQAFSDSTDSSTPKPKVVIIHDAVRPFVEEDLLLKITLAAKEQGASGAIRPLVSTVIATTSESYLDHSLERAKYRASEMPQGFLYDIIFQAYQRCSEFDLEFGTECLHLALQYCGTNARLIEGPPTLWKVTYKRDLAAAEAIIKETLSVSACIIAEAEEEAVELAKTLQKNLNMMETDVIPCGKESNVQYLSKTRNFIHISASASSSSWVLEMVKCFEDIDHARLYPVVIVWVQLSKTKQSADSQETDEFMALASEVKQRNVLLYGIKIDHSKELEQWQRSLERLGQITLVLIRDRNMALTGQMLHV |
Gene Information
Entrez Gene ID
Gene Name
isoprenoid synthase domain containing
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016779 | IEA:UniProtKB-KW | F | nucleotidyltransferase activity |
GO:0048854 | IMP:ZFIN | P | brain morphogenesis |
GO:0008299 | IEA:InterPro | P | isoprenoid biosynthetic process |
GO:0048747 | IMP:ZFIN | P | muscle fiber development |
GO:0035269 | IMP:UniProtKB | P | protein O-linked mannosylation |
GO:0060049 | IMP:ZFIN | P | regulation of protein glycosylation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
isoprenoid synthase domain containing
Protein Entry
ISPD_DANRE
UniProt ID
Species
Zebrafish
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=A0JPF9-1; Sequence=Displayed; Name=2; IsoId=A0JPF9-2; Sequence=VSP_044045; Name=3; IsoId=A0JPF9-3; Sequence=VSP_044046; Note=No experimental confirmation available.; |
Disruption Phenotype | Hydrocephalus and incomplete brain folding by 48 hours post fertilization (h.p.f.), as well as significantly reduced eye size reminiscent of microphthalmia in patients suffering of muscular dystrophy-dystroglycanopathy congenital with brain and eye anomalies in human. {ECO:0000269|PubMed:22522421}. |
Function | Required for protein O-linked mannosylation. Probably acts as a nucleotidyltransferase involved in synthesis of a nucleotide sugar. Required for dystroglycan O-mannosylation. {ECO:0000269|PubMed:22522421}. |
Pathway | Protein modification; protein glycosylation. |
Similarity | Belongs to the IspD family. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012273 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
118150626 | RefSeq | NP_001071270 | 462 | isoprenoid synthase domain-containing protein |
Identical Sequences to LMP012273 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:118150626 | GenBank | AAI27406.1 | 462 | Zgc:154151 [Danio rerio] |
Related Sequences to LMP012273 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:118150626 | RefSeq | XP_005157821.1 | 448 | PREDICTED: isoprenoid synthase domain-containing protein isoform X1 [Danio rerio] |
GI:118150626 | RefSeq | XP_003450340.2 | 433 | PREDICTED: isoprenoid synthase domain-containing protein-like isoform X1 [Oreochromis niloticus] |
GI:118150626 | RefSeq | XP_005739306.1 | 433 | PREDICTED: isoprenoid synthase domain-containing protein-like [Pundamilia nyererei] |
GI:118150626 | RefSeq | XP_007232398.1 | 437 | PREDICTED: isoprenoid synthase domain-containing protein [Astyanax mexicanus] |
GI:118150626 | RefSeq | XP_009290082.1 | 275 | PREDICTED: isoprenoid synthase domain-containing protein isoform X2 [Danio rerio] |
GI:118150626 | SwissProt | A0JPF9.2 | 462 | RecName: Full=Isoprenoid synthase domain-containing protein; AltName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase-like protein [Danio rerio] |