Gene/Proteome Database (LMPD)
Proteins
| 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial | |
|---|---|
| Refseq ID | NP_001082927 |
| Protein GI | 147905866 |
| UniProt ID | A3KNB0 |
| mRNA ID | NM_001089458 |
| Length | 505 |
| RefSeq Status | PROVISIONAL |
| MRAHLQRAPQILELLKKKTVGLQHCKPTSSVCVLDSKDAAGSAPCAHSLDSIPGPTNWPLFGSLIEVIRNGGLKRQHETLIHFHKKFGKIFRMKLGSFESVHIGSPCLLEALYRKEGSYPERLEIKPWKAYRDMRDEAYGLLILEGRDWQRVRSAFQQKLMKPTEVMKLDGKINEVAADLIKRIGKVNGKMDALYFELNKWSFETICYVIYDKRFGLLQDSVSKEGMDFITAVKTMMSTFGTMMVTPVELHKTLNTKTWKDHTEAWDRIFSTAKHYIDKNLQKQSNGEADDFLSDIFHNGNLTKKELYAATTELQVGGVETTANSMLWVIFNLSRNPCAQGKLLKEIQDVVPAGQTPRAEHIKSMPYLKACLKESMRVSPSVPFTSRTLDKDTVLGDYTLPKGTVLMLNSQAIGVSEEYFDNGRQFRPERWLEEKSSINPFAHVPFGVGKRMCIGRRLAELQIQLGLCWILRDYKIVATDLEPVDSLHSGTLVPSRELPVAFVPR | |
Gene Information
Entrez Gene ID
Gene Name
cytochrome P450, family 24, subfamily A, polypeptide 1
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0020037 | IEA:InterPro | F | heme binding |
| GO:0005506 | IEA:InterPro | F | iron ion binding |
| GO:0004497 | IEA:UniProtKB-KW | F | monooxygenase activity |
| GO:0016705 | IEA:InterPro | F | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen |
Domain Information
UniProt Annotations
Entry Information
Gene Name
cytochrome P450, family 24, subfamily A, polypeptide 1
Protein Entry
A3KNB0_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP012300 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 147905866 | RefSeq | NP_001082927 | 505 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial |
Identical Sequences to LMP012300 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:147905866 | GenBank | AAI33741.1 | 505 | Cyp24a1l protein [Danio rerio] |
Related Sequences to LMP012300 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:147905866 | GenBank | ACN11270.1 | 516 | Cytochrome P450 24A1, mitochondrial precursor [Salmo salar] |
| GI:147905866 | RefSeq | XP_003456149.1 | 513 | PREDICTED: 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial-like isoform 1 [Oreochromis niloticus] |
| GI:147905866 | RefSeq | XP_004547659.1 | 513 | PREDICTED: 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial-like [Maylandia zebra] |
| GI:147905866 | RefSeq | XP_005729876.1 | 513 | PREDICTED: 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial-like [Pundamilia nyererei] |
| GI:147905866 | RefSeq | XP_007252736.1 | 511 | PREDICTED: 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial-like [Astyanax mexicanus] |
| GI:147905866 | RefSeq | XP_008300198.1 | 513 | PREDICTED: 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial [Stegastes partitus] |