Gene/Proteome Database (LMPD)

LMPD ID
LMP012355
Gene ID
Species
Homo sapiens (Human)
Gene Name
ALG5, dolichyl-phosphate beta-glucosyltransferase
Gene Symbol
Synonyms
bA421P11.2;
Chromosome
13
Map Location
13q13.3
EC Number
2.4.1.117
Summary
This gene encodes a member of the glycosyltransferase 2 family. The encoded protein participates in glucosylation of the oligomannose core in N-linked glycosylation of proteins. The addition of glucose residues to the oligomannose core is necessary to ensure substrate recognition, and therefore, effectual transfer of the oligomannose core to the nascent glycoproteins. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2008]
Orthologs

Proteins

dolichyl-phosphate beta-glucosyltransferase isoform 1
Refseq ID NP_037470
Protein GI 7019323
UniProt ID Q9Y673
mRNA ID NM_013338
Length 324
MAPLLLQLAVLGAALAAAALVLISIVAFTTATKMPALHRHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQMAIACGSRAHLEKESIAQRSYFRTLLMYGFHFLVWFLCVKGIRDTQCGFKLFTREAASRTFSSLHVERWAFDVELLYIAQFFKIPIAEIAVNWTEIEGSKLVPFWSWLQMGKDLLFIRLRYLTGAWRLEQTRKMN
dolichyl-phosphate beta-glucosyltransferase isoform 2
Refseq ID NP_001135836
Protein GI 215276969
UniProt ID Q9Y673
mRNA ID NM_001142364
Length 294
MAPLLLQLAVLGAALAAAALVLISIVAFTTATKMPALHRHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQMAIACGSRAHLEKESIAQRSYFRTLLMYGFHFLVWFLCVKGIRDTQCGFKLFTREAASRTFSSLHVERWAFDVELLYIAQFFKIPIAEIAVNWTEIEGSKLVPFWSWLQMGKDLLFIRLRYLTGAWRLEQTRKMN

Gene Information

Entrez Gene ID
Gene Name
ALG5, dolichyl-phosphate beta-glucosyltransferase
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 TAS:Reactome C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016020 IDA:UniProtKB C membrane
GO:0004581 IEA:UniProtKB-EC F dolichyl-phosphate beta-glucosyltransferase activity
GO:0004576 TAS:ProtInc F oligosaccharyl transferase activity
GO:0044267 TAS:Reactome P cellular protein metabolic process
GO:0007368 IEA:Ensembl P determination of left/right symmetry
GO:0006488 TAS:Reactome P dolichol-linked oligosaccharide biosynthetic process
GO:0043687 TAS:Reactome P post-translational protein modification
GO:0018279 TAS:Reactome P protein N-linked glycosylation via asparagine
GO:0006486 TAS:ProtInc P protein glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
hsa01100 Metabolic pathways
hsa00510 N-Glycan biosynthesis
ko00510 N-Glycan biosynthesis
M00055 N-glycan precursor biosynthesis

BIOCYC Pathway Links

BIOCYC Pathway ID Description
MANNOSYL-CHITO-DOLICHOL-BIOSYNTHESIS dolichyl-diphosphooligosaccharide biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_22426 Asparagine N-linked glycosylation
REACT_22433 Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
REACT_17015 Metabolism of proteins
REACT_22161 Post-translational protein modification
REACT_22346 Synthesis of dolichyl-phosphate-glucose
REACT_22387 Synthesis of substrates in N-glycan biosythesis

Domain Information

InterPro Annotations

Accession Description
IPR001173 Glycosyltransferase 2-like
IPR029044 Nucleotide-diphospho-sugar transferases

UniProt Annotations

Entry Information

Gene Name
ALG5, dolichyl-phosphate beta-glucosyltransferase
UniProt ID
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9Y673-1; Sequence=Displayed; Name=2; IsoId=Q9Y673-2; Sequence=VSP_041019; Note=No experimental confirmation available.;
Catalytic Activity UDP-glucose + dolichyl phosphate = UDP + dolichyl beta-D-glucosyl phosphate.
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the glycosyltransferase 2 family
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Single-pass type II membrane protein
Tissue Specificity Expressed in pancreas, placenta, liver, heart, brain, kidney, skeletal muscle, and lung.
Web Resource Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=ALG5";

Identical and Related Proteins

Unique RefSeq proteins for LMP012355 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
7019323 RefSeq NP_037470 324 dolichyl-phosphate beta-glucosyltransferase isoform 1
215276969 RefSeq NP_001135836 294 dolichyl-phosphate beta-glucosyltransferase isoform 2

Identical Sequences to LMP012355 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP012355 proteins

Reference Database Accession Length Protein Name