Gene/Proteome Database (LMPD)
LMPD ID
LMP012355
Gene ID
Species
Homo sapiens (Human)
Gene Name
ALG5, dolichyl-phosphate beta-glucosyltransferase
Gene Symbol
Synonyms
bA421P11.2;
Chromosome
13
Map Location
13q13.3
EC Number
2.4.1.117
Summary
This gene encodes a member of the glycosyltransferase 2 family. The encoded protein participates in glucosylation of the oligomannose core in N-linked glycosylation of proteins. The addition of glucose residues to the oligomannose core is necessary to ensure substrate recognition, and therefore, effectual transfer of the oligomannose core to the nascent glycoproteins. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2008]
Orthologs
Proteins
dolichyl-phosphate beta-glucosyltransferase isoform 1 | |
---|---|
Refseq ID | NP_037470 |
Protein GI | 7019323 |
UniProt ID | Q9Y673 |
mRNA ID | NM_013338 |
Length | 324 |
MAPLLLQLAVLGAALAAAALVLISIVAFTTATKMPALHRHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQMAIACGSRAHLEKESIAQRSYFRTLLMYGFHFLVWFLCVKGIRDTQCGFKLFTREAASRTFSSLHVERWAFDVELLYIAQFFKIPIAEIAVNWTEIEGSKLVPFWSWLQMGKDLLFIRLRYLTGAWRLEQTRKMN |
dolichyl-phosphate beta-glucosyltransferase isoform 2 | |
---|---|
Refseq ID | NP_001135836 |
Protein GI | 215276969 |
UniProt ID | Q9Y673 |
mRNA ID | NM_001142364 |
Length | 294 |
MAPLLLQLAVLGAALAAAALVLISIVAFTTATKMPALHRHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQMAIACGSRAHLEKESIAQRSYFRTLLMYGFHFLVWFLCVKGIRDTQCGFKLFTREAASRTFSSLHVERWAFDVELLYIAQFFKIPIAEIAVNWTEIEGSKLVPFWSWLQMGKDLLFIRLRYLTGAWRLEQTRKMN |
Gene Information
Entrez Gene ID
Gene Name
ALG5, dolichyl-phosphate beta-glucosyltransferase
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0016020 | IDA:UniProtKB | C | membrane |
GO:0004581 | IEA:UniProtKB-EC | F | dolichyl-phosphate beta-glucosyltransferase activity |
GO:0004576 | TAS:ProtInc | F | oligosaccharyl transferase activity |
GO:0044267 | TAS:Reactome | P | cellular protein metabolic process |
GO:0007368 | IEA:Ensembl | P | determination of left/right symmetry |
GO:0006488 | TAS:Reactome | P | dolichol-linked oligosaccharide biosynthetic process |
GO:0043687 | TAS:Reactome | P | post-translational protein modification |
GO:0018279 | TAS:Reactome | P | protein N-linked glycosylation via asparagine |
GO:0006486 | TAS:ProtInc | P | protein glycosylation |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
hsa01100 | Metabolic pathways |
hsa00510 | N-Glycan biosynthesis |
ko00510 | N-Glycan biosynthesis |
M00055 | N-glycan precursor biosynthesis |
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
MANNOSYL-CHITO-DOLICHOL-BIOSYNTHESIS | dolichyl-diphosphooligosaccharide biosynthesis |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
REACT_22426 | Asparagine N-linked glycosylation |
REACT_22433 | Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein |
REACT_17015 | Metabolism of proteins |
REACT_22161 | Post-translational protein modification |
REACT_22346 | Synthesis of dolichyl-phosphate-glucose |
REACT_22387 | Synthesis of substrates in N-glycan biosythesis |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9Y673-1; Sequence=Displayed; Name=2; IsoId=Q9Y673-2; Sequence=VSP_041019; Note=No experimental confirmation available.; |
Catalytic Activity | UDP-glucose + dolichyl phosphate = UDP + dolichyl beta-D-glucosyl phosphate. |
Pathway | Protein modification; protein glycosylation. |
Similarity | Belongs to the glycosyltransferase 2 family |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Single-pass type II membrane protein |
Tissue Specificity | Expressed in pancreas, placenta, liver, heart, brain, kidney, skeletal muscle, and lung. |
Web Resource | Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=ALG5"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP012355 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
7019323 | RefSeq | NP_037470 | 324 | dolichyl-phosphate beta-glucosyltransferase isoform 1 |
215276969 | RefSeq | NP_001135836 | 294 | dolichyl-phosphate beta-glucosyltransferase isoform 2 |
Identical Sequences to LMP012355 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP012355 proteins
Reference | Database | Accession | Length | Protein Name |
---|