Gene/Proteome Database (LMPD)
LMPD ID
LMP012358
Gene ID
Species
Homo sapiens (Human)
Gene Name
all-trans retinoic acid-induced differentiation factor
Gene Symbol
Synonyms
p18; APR3; APR-3; APR--3; PRO240; C2orf28; HSPC013;
Chromosome
2
Map Location
2p23.3
Summary
This gene is thought to be involved in apoptosis, and may also be involved in hematopoietic development and differentiation. The use of alternative splice sites and promotors result in multiple transcript variants encoding different isoforms.[provided by RefSeq, Dec 2009]
Orthologs
Proteins
| all-trans retinoic acid-induced differentiation factor isoform a | |
|---|---|
| Refseq ID | NP_057169 |
| Protein GI | 18105012 |
| UniProt ID | Q6UW56 |
| mRNA ID | NM_016085 |
| Length | 171 |
| MLHARCCLNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILPQHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS | |
| all-trans retinoic acid-induced differentiation factor isoform b | |
|---|---|
| Refseq ID | NP_542159 |
| Protein GI | 282847378 |
| UniProt ID | Q6UW56 |
| mRNA ID | NM_080592 |
| Length | 284 |
| MKTSAELHEQEKPPSSPRATGPGRLGHARGRGPDALRGGAAGPGRASSGAPRERKMAPHDPGSLTTLVPWAAALLLALGVERALALPEICTQCPGSVQNLSKVAFYCKTTRELMLHARCCLNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILPQHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS | |
| sig_peptide: 1..30 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3056 peptide sequence: MAPHDPGSLTTLVPWAAALLLALGVERALA mat_peptide: 31..229 product: all-trans retinoic acid-induced differentiation factor isoform c calculated_mol_wt: 21709 peptide sequence: LPEICTQCPGSVQNLSKVAFYCKTTRELMLHARCCLNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILPQHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS | |
| all-trans retinoic acid-induced differentiation factor isoform c precursor | |
|---|---|
| Refseq ID | NP_001164266 |
| Protein GI | 282847380 |
| UniProt ID | Q6UW56 |
| mRNA ID | NM_001170795 |
| Length | 229 |
| MAPHDPGSLTTLVPWAAALLLALGVERALALPEICTQCPGSVQNLSKVAFYCKTTRELMLHARCCLNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILPQHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS | |
Gene Information
Entrez Gene ID
Gene Name
all-trans retinoic acid-induced differentiation factor
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005635 | IDA:UniProtKB | C | nuclear envelope |
| GO:0048471 | IDA:UniProtKB | C | perinuclear region of cytoplasm |
| GO:0005886 | IEA:UniProtKB-KW | C | plasma membrane |
| GO:0030154 | IEA:UniProtKB-KW | P | cell differentiation |
| GO:2000599 | IDA:UniProtKB | P | negative regulation of cyclin catabolic process |
| GO:0033689 | IDA:UniProtKB | P | negative regulation of osteoblast proliferation |
| GO:0030501 | IDA:UniProtKB | P | positive regulation of bone mineralization |
| GO:0045669 | IDA:UniProtKB | P | positive regulation of osteoblast differentiation |
| GO:0010468 | IDA:UniProtKB | P | regulation of gene expression |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative promoter usage, Alternative splicing; Named isoforms=3; Name=1; IsoId=Q6UW56-1; Sequence=Displayed; Name=2; IsoId=Q6UW56-2; Sequence=VSP_014108; Note=Produced by alternative splicing of isoform 1. No experimental confirmation available.; Name=3; IsoId=Q6UW56-3; Sequence=VSP_037521; Note=Produced by alternative promoter usage.; |
| Function | Promotes osteoblast cell differentiation and terminal mineralization. Plays a role in inducing the cell cycle arrest via inhibiting CCND1 expression in all-trans-retinoic acid (ATRA) signal pathway |
| Induction | Up-regulated by all-trans-retinoic acid (ATRA) in several tumor cell lines |
| Interaction | Q92832:NELL1; NbExp=4; IntAct=EBI-723802, EBI-947754; Q9Y5X1:SNX9; NbExp=2; IntAct=EBI-723802, EBI-77848; |
| Sequence Caution | Sequence=AAD27770.1; Type=Frameshift; Positions=19; Evidence= ; Sequence=AAD31317.2; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAD31317.2; Type=Frameshift; Positions=189; Evidence= ; Sequence=AAH02846.2; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAH11006.3; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAH35850.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ; Sequence=AAX93173.1; Type=Erroneous gene model prediction; Evidence= ; |
| Similarity | Contains 1 EGF-like domain. {ECO:0000255|PROSITE- ProRule:PRU00076}. |
| Subcellular Location | Nucleus envelope. Cell membrane; Single-pass membrane protein. Note=Colocalizes with NELL1 on the nuclear envelope and the perinuclear region. |
| Subunit | Interacts with NELL1; the interaction promotes osteoblastic differentiation and mineralization |
| Tissue Specificity | Weakly expressed in hematopoietic cell lines |
Identical and Related Proteins
Unique RefSeq proteins for LMP012358 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 18105012 | RefSeq | NP_057169 | 171 | all-trans retinoic acid-induced differentiation factor isoform a |
| 282847378 | RefSeq | NP_542159 | 284 | all-trans retinoic acid-induced differentiation factor isoform b |
| 282847380 | RefSeq | NP_001164266 | 229 | all-trans retinoic acid-induced differentiation factor isoform c precursor |
Identical Sequences to LMP012358 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP012358 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|