Gene/Proteome Database (LMPD)

LMPD ID
LMP012384
Gene ID
Species
Homo sapiens (Human)
Gene Name
retinol dehydrogenase 8 (all-trans)
Gene Symbol
Synonyms
PRRDH; SDR28C2;
Chromosome
19
Map Location
19p13.2
EC Number
1.1.1.300
Summary
This gene encodes a member of the short-chain dehydrogenase/reductase family. The encoded protein catalyzes the reduction of all-trans-retinal to all-trans-retinol, the first reaction step of the rhodopsin regeneration pathway. This enzymatic reaction is the rate-limiting step in the visual cycle. [provided by RefSeq, Feb 2014]
Orthologs

Proteins

retinol dehydrogenase 8
Refseq ID NP_056540
Protein GI 393535067
UniProt ID Q9NYR8
mRNA ID NM_015725
Length 331
MNGQSQVLPGGGHESREGINMAAAPRTVLISGCSSGIGLELAVQLAHDPKKRYQVVATMRDLGKKETLEAAAGEALGQTLTVAQLDVCSDESVAQCLSCIQGEVDVLVNNAGMGLVGPLEGLSLAAMQNVFDTNFFGAVRLVKAVLPGMKRRRQGHIVVISSVMGLQGVIFNDVYAASKFALEGFFESLAIQLLQFNIFISLVEPGPVVTEFEGKLLAQVSMAEFPGTDPETLHYFRDLYLPASRKLFCSVGQNPQDVVQAIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRTTHRLLFRCPRLLNLGLQCLSCGCLPTRVRPR

Gene Information

Entrez Gene ID
Gene Name
retinol dehydrogenase 8 (all-trans)
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:InterPro C cytoplasm
GO:0005887 TAS:ProtInc C integral component of plasma membrane
GO:0052650 IEA:UniProtKB-EC F NADP-retinol dehydrogenase activity
GO:0004303 IEA:InterPro F estradiol 17-beta-dehydrogenase activity
GO:0004745 TAS:ProtInc F retinol dehydrogenase activity
GO:0006703 IEA:InterPro P estrogen biosynthetic process
GO:0007603 TAS:Reactome P phototransduction, visible light
GO:0001523 TAS:Reactome P retinoid metabolic process
GO:0006694 TAS:ProtInc P steroid biosynthetic process
GO:0007601 TAS:ProtInc P visual perception

KEGG Pathway Links

KEGG Pathway ID Description
hsa01100 Metabolic pathways
hsa00830 Retinol metabolism
ko00830 Retinol metabolism

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-6857 retinol biosynthesis
PWY-6857 retinol biosynthesis
PWY-6861 the visual cycle I (vertebrates)
PWY-6861 the visual cycle I (vertebrates)

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_116125 Disease
REACT_160102 Diseases associated with visual transduction
REACT_111102 Signal Transduction
REACT_160156 The canonical retinoid cycle in rods (twilight vision)
REACT_160125 Visual phototransduction

Domain Information

InterPro Annotations

Accession Description
IPR011348 17beta-dehydrogenase
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR
IPR020904 Short-chain dehydrogenase/reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
retinol dehydrogenase 8 (all-trans)
Protein Entry
RDH8_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Catalytic Activity All-trans-retinol + NADP(+) = all-trans- retinal + NADPH.
Function Retinol dehydrogenase with a clear preference for NADP. Converts all-trans-retinal to all-trans-retinol. May play a role in the regeneration of visual pigment at high light intensity (By similarity)
Sequence Caution Sequence=BAB14782.1; Type=Frameshift; Positions=26; Evidence= ;
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family
Subcellular Location Membrane ; Multi-pass membrane protein
Tissue Specificity Detected in photoreceptor outer segments in the retina (at protein level)

Identical and Related Proteins

Unique RefSeq proteins for LMP012384 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
393535067 RefSeq NP_056540 331 retinol dehydrogenase 8

Identical Sequences to LMP012384 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP012384 proteins

Reference Database Accession Length Protein Name