Gene/Proteome Database (LMPD)

LMPD ID
LMP012392
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
apolipoprotein C-III
Gene Symbol
Synonyms
ApoC-III; apo-CIII;
Alternate Names
apolipoprotein C-III; apolipoprotein C3; apolipoprotein C-3;
Chromosome
8
Map Location
8q23-q24
Summary
very low density lipoprotein (VLDL) that comprises a major component of the lipid transport system; increased levels induce hypertriglyceridemia [RGD, Feb 2006]
Orthologs

Proteins

apolipoprotein C-III precursor
Refseq ID NP_036633
Protein GI 402534546
mRNA ID NM_012501
Length 100
MQPRMLLIVALVALLASARADEGEGSLLLGSMQGYMEQASKTVQDALSSMQESDIAVVARGWMDNRFKSLKGYWSKFTDKFTGLWESGPEDQLTTPTLEP
sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2138 peptide sequence: MQPRMLLIVALVALLASARA mat_peptide: 21..100 product: apolipoprotein C-III calculated_mol_wt: 8910 peptide sequence: DEGEGSLLLGSMQGYMEQASKTVQDALSSMQESDIAVVARGWMDNRFKSLKGYWSKFTDKFTGLWESGPEDQLTTPTLEP sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2138 peptide sequence: MQPRMLLIVALVALLASARA mat_peptide: 21..100 product: apolipoprotein C-III calculated_mol_wt: 8910 peptide sequence: DEGEGSLLLGSMQGYMEQASKTVQDALSSMQESDIAVVARGWMDNRFKSLKGYWSKFTDKFTGLWESGPEDQLTTPTLEP
apolipoprotein C-III precursor
Refseq ID NP_001257982
Protein GI 402534548
mRNA ID NM_001271053
Length 100
Protein sequence is identical to GI:402534546 (mRNA isoform)
sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2138 peptide sequence: MQPRMLLIVALVALLASARA mat_peptide: 21..100 product: apolipoprotein C-III calculated_mol_wt: 8910 peptide sequence: DEGEGSLLLGSMQGYMEQASKTVQDALSSMQESDIAVVARGWMDNRFKSLKGYWSKFTDKFTGLWESGPEDQLTTPTLEP

Gene Information

Entrez Gene ID
Gene Name
apolipoprotein C-III
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0042627 IEA:UniProtKB-KW C chylomicron
GO:0005615 IDA:RGD C extracellular space
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0034363 IEA:Ensembl C intermediate-density lipoprotein particle
GO:0034366 IEA:Ensembl C spherical high-density lipoprotein particle
GO:0034361 IEA:UniProtKB-KW C very-low-density lipoprotein particle
GO:0055102 IEA:Ensembl F lipase inhibitor activity
GO:0005319 TAS:RGD F lipid transporter activity
GO:0005543 IEA:Ensembl F phospholipid binding
GO:0007186 IEA:Ensembl P G-protein coupled receptor signaling pathway
GO:0071333 IDA:RGD P cellular response to glucose stimulus
GO:0033344 IEA:Ensembl P cholesterol efflux
GO:0042632 IEA:Ensembl P cholesterol homeostasis
GO:0008203 IEA:Ensembl P cholesterol metabolic process
GO:0034382 IEA:Ensembl P chylomicron remnant clearance
GO:0034375 IEA:Ensembl P high-density lipoprotein particle remodeling
GO:0006954 IEP:RGD P inflammatory response
GO:0006869 TAS:RGD P lipid transport
GO:0042157 IEA:InterPro P lipoprotein metabolic process
GO:0042953 IDA:RGD P lipoprotein transport
GO:0060621 IEA:Ensembl P negative regulation of cholesterol import
GO:0045717 IEA:Ensembl P negative regulation of fatty acid biosynthetic process
GO:0010987 IEA:Ensembl P negative regulation of high-density lipoprotein particle clearance
GO:0051005 IEA:Ensembl P negative regulation of lipoprotein lipase activity
GO:0010989 IEA:Ensembl P negative regulation of low-density lipoprotein particle clearance
GO:0048261 IEA:Ensembl P negative regulation of receptor-mediated endocytosis
GO:0010897 IEA:Ensembl P negative regulation of triglyceride catabolic process
GO:0010916 IEA:Ensembl P negative regulation of very-low-density lipoprotein particle clearance
GO:0033700 IEA:Ensembl P phospholipid efflux
GO:0032489 IEA:Ensembl P regulation of Cdc42 protein signal transduction
GO:0042493 IEP:RGD P response to drug
GO:0007584 IEP:RGD P response to nutrient
GO:0043434 IDA:RGD P response to peptide hormone
GO:0019433 IEA:Ensembl P triglyceride catabolic process
GO:0070328 IEA:Ensembl P triglyceride homeostasis
GO:0006642 IEA:Ensembl P triglyceride mobilization

KEGG Pathway Links

KEGG Pathway ID Description
ko03320 PPAR signaling pathway
rno03320 PPAR signaling pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
5953879 Chylomicron-mediated lipid transport
5953253 Disease
5953382 Diseases associated with visual transduction
5954088 HDL-mediated lipid transport
5953754 Lipid digestion, mobilization, and transport
5953836 Lipoprotein metabolism
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5954392 Retinoid metabolism and transport
5953381 Signal Transduction
5953380 Visual phototransduction

Domain Information

InterPro Annotations

Accession Description
IPR008403 Apolipoprotein CIII

UniProt Annotations

Entry Information

Gene Name
apolipoprotein C-III
Species
Rat

Comments

Comment Type Description
Function Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. {ECO:0000250|UniProtKB:P02656}.
Ptm The most abundant glycoforms are characterized by an O-linked disaccharide galactose linked to N-acetylgalactosamine (Gal- GalNAc), further modified with up to 3 sialic acid residues. Less abundant glycoforms are characterized by more complex and fucosylated glycan moieties. O-glycosylated on Thr-96 with a core 1 or possibly core 8 glycan. {ECO:0000250|UniProtKB:P02656}.
Similarity Belongs to the apolipoprotein C3 family. {ECO:0000305}.
Subcellular Location Secreted {ECO:0000250|UniProtKB:P02656}.
Tissue Specificity Synthesized predominantly in liver and to a lesser degree in intestine. {ECO:0000269|PubMed:3020028}.

Identical and Related Proteins

Unique RefSeq proteins for LMP012392 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
402534546 RefSeq NP_036633 100 apolipoprotein C-III precursor

Identical Sequences to LMP012392 proteins

Reference Database Accession Length Protein Name
GI:402534548 GenBank EDL95395.1 100 apolipoprotein C-III, isoform CRA_a [Rattus norvegicus]
GI:402534546 GenBank EDL95395.1 100 apolipoprotein C-III, isoform CRA_a [Rattus norvegicus]
GI:402534548 RefSeq NP_036633.2 100 apolipoprotein C-III precursor [Rattus norvegicus]
GI:402534546 RefSeq NP_001257982.1 100 apolipoprotein C-III precursor [Rattus norvegicus]

Related Sequences to LMP012392 proteins

Reference Database Accession Length Protein Name
GI:402534548 GenBank AAA40746.1 101 preapolipoprotein C-III [Rattus norvegicus]
GI:402534548 GenBank EDL95395.1 100 apolipoprotein C-III, isoform CRA_a [Rattus norvegicus]
GI:402534546 GenBank EDL95395.1 100 apolipoprotein C-III, isoform CRA_a [Rattus norvegicus]
GI:402534548 RefSeq NP_036633.2 100 apolipoprotein C-III precursor [Rattus norvegicus]
GI:402534546 RefSeq NP_001257982.1 100 apolipoprotein C-III precursor [Rattus norvegicus]
GI:402534546 SwissProt P06759.2 101 RecName: Full=Apolipoprotein C-III; Short=Apo-CIII; Short=ApoC-III; AltName: Full=Apolipoprotein C3; Flags: Precursor [Rattus norvegicus]
GI:402534548 SwissProt P06759.2 101 RecName: Full=Apolipoprotein C-III; Short=Apo-CIII; Short=ApoC-III; AltName: Full=Apolipoprotein C3; Flags: Precursor [Rattus norvegicus]