Gene/Proteome Database (LMPD)

LMPD ID
LMP012397
Gene ID
24297
Species
Rattus norvegicus (Rat)
Gene Name
cytochrome P450, family 1, subfamily a, polypeptide 2
Gene Symbol
Cyp1a2
Synonyms
CYPD45; P-450d; RATCYPD45;
Alternate Names
cytochrome P450 1A2; P-448; CYPIA2; P450-D; cytochrome P-448; cytochrome P-450d; cytochrome P450-D; cytochrome P450, 1a2; Cytochrome P450 subfamily I (aromatic compound-inducible) member A2 (Q42 form d); cytochrome P450, subfamily I (aromatic compound-inducible), member A2 (Q42, form d);
Chromosome
8
Map Location
8q24
EC Number
1.14.14.1
Summary
a monooxygenase that may play a role in xenobiotic metabolism [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Cyp1a2

Proteins

cytochrome P450 1A2
Refseq ID NP_036673
Protein GI 158186713
UniProt ID P04799
mRNA ID NM_012541
Length 513
MAFSQYISLAPELLLATAIFCLVFWVLRGTRTQVPKGLKSPPGPWGLPFIGHMLTLGKNPHLSLTKLSQQYGDVLQIRIGSTPVVVLSGLNTIKQALVKQGDDFKGRPDLYSFTLITNGKSMTFNPDSGPVWAARRRLAQDALKSFSIASDPTSVSSCYLEEHVSKEANHLISKFQKLMAEVGHFEPVNQVVESVANVIGAMCFGKNFPRKSEEMLNLVKSSKDFVENVTSGNAVDFFPVLRYLPNPALKRFKNFNDNFVLFLQKTVQEHYQDFNKNSIQDITGALFKHSENYKDNGGLIPQEKIVNIVNDIFGAGFETVTTAIFWSILLLVTEPKVQRKIHEELDTVIGRDRQPRLSDRPQLPYLEAFILEIYRYTSFVPFTIPHSTTRDTSLNGFHIPKECCIFINQWQVNHDEKQWKDPFVFRPERFLTNDNTAIDKTLSEKVMLFGLGKRRCIGEIPAKWEVFLFLAILLHQLEFTVPPGVKVDLTPSYGLTMKPRTCEHVQAWPRFSK

Gene Information

Entrez Gene ID
24297
Gene Name
cytochrome P450, family 1, subfamily a, polypeptide 2
Gene Symbol
Cyp1a2
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0043231 IDA:RGD C intracellular membrane-bounded organelle
GO:0016020 IEA:UniProtKB-KW C membrane
GO:0070330 IEA:UniProtKB-EC F aromatase activity
GO:0034875 IEA:Ensembl F caffeine oxidase activity
GO:0032451 IEA:Ensembl F demethylase activity
GO:0020037 ISS:UniProtKB F heme binding
GO:0005506 IEA:InterPro F iron ion binding
GO:0004497 IDA:RGD F monooxygenase activity
GO:0016712 IDA:RGD F oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
GO:0009820 IEA:Ensembl P alkaloid metabolic process
GO:0045333 IEA:Ensembl P cellular respiration
GO:0071276 IEA:Ensembl P cellular response to cadmium ion
GO:0018894 IEA:Ensembl P dibenzo-p-dioxin metabolic process
GO:0042738 IEA:Ensembl P exogenous drug catabolic process
GO:0050665 IEA:Ensembl P hydrogen peroxide biosynthetic process
GO:0030324 IEA:Ensembl P lung development
GO:0032787 IEA:Ensembl P monocarboxylic acid metabolic process
GO:0016098 IEA:Ensembl P monoterpenoid metabolic process
GO:0071615 IEA:Ensembl P oxidative deethylation
GO:0070989 IEA:Ensembl P oxidative demethylation
GO:0006778 IEA:Ensembl P porphyrin-containing compound metabolic process
GO:0009791 IEA:Ensembl P post-embryonic development
GO:0010468 IEA:Ensembl P regulation of gene expression
GO:0042493 IEP:RGD P response to drug
GO:0032355 IEP:RGD P response to estradiol
GO:0035902 IEP:RGD P response to immobilization stress
GO:0032496 IEP:RGD P response to lipopolysaccharide
GO:0014070 IEP:RGD P response to organic cyclic compound
GO:0010033 IEP:RGD P response to organic substance
GO:0006706 IEA:Ensembl P steroid catabolic process
GO:0009403 IEA:Ensembl P toxin biosynthetic process
GO:0006805 TAS:RGD P xenobiotic metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00232 Caffeine metabolism
rno00232 Caffeine metabolism
ko05204 Chemical carcinogenesis
rno05204 Chemical carcinogenesis
ko00982 Drug metabolism - cytochrome P450
rno00982 Drug metabolism - cytochrome P450
ko00591 Linoleic acid metabolism
rno00591 Linoleic acid metabolism
rno01100 Metabolic pathways
ko00980 Metabolism of xenobiotics by cytochrome P450
rno00980 Metabolism of xenobiotics by cytochrome P450
ko00830 Retinol metabolism
rno00830 Retinol metabolism
ko00140 Steroid hormone biosynthesis
rno00140 Steroid hormone biosynthesis
ko00380 Tryptophan metabolism
rno00380 Tryptophan metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
5953686 Aflatoxin activation and detoxification
5953493 Arachidonic acid metabolism
5953486 Aromatic amines can be N-hydroxylated or N-dealkylated by CYP1A2
5953258 Biological oxidations
5953485 Cytochrome P450 - arranged by substrate type
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5953487 Methylation
5953326 Phase 1 - Functionalization of compounds
5953257 Phase II conjugation
5954554 Synthesis of (16-20)-hydroxyeicosatetraenoic acids (HETE)
5954555 Synthesis of epoxy (EET) and dihydroxyeicosatrienoic acids (DHET)
5953484 Xenobiotics

Domain Information

InterPro Annotations

Accession Description
IPR001128 Cytochrome P450
IPR002401 Cytochrome P450, E-class, group I
IPR008066 Cytochrome P450, E-class, group I, CYP1
IPR017972 Cytochrome P450, conserved site

UniProt Annotations

Entry Information

Gene Name
cytochrome P450, family 1, subfamily a, polypeptide 2
Protein Entry
CP1A2_RAT
UniProt ID
P04799
Species
Rat

Comments

Comment Type Description
Catalytic Activity RH + reduced flavoprotein + O(2) = ROH + oxidized flavoprotein + H(2)O.
Cofactor Name=heme; Xref=ChEBI:CHEBI:30413; Evidence= ;
Function Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Most active in catalyzing 2-hydroxylation (By similarity)
Induction By 3-methylcholanthrene (3MC).
Similarity Belongs to the cytochrome P450 family
Subcellular Location Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein.

Identical and Related Proteins

Unique RefSeq proteins for LMP012397 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
158186713 RefSeq NP_036673 513 cytochrome P450 1A2

Identical Sequences to LMP012397 proteins

Reference Database Accession Length Protein Name
GI:158186713 GenBank AAI27477.1 513 Cytochrome P450, family 1, subfamily a, polypeptide 2 [Rattus norvegicus]
GI:158186713 SwissProt P04799.2 513 RecName: Full=Cytochrome P450 1A2; AltName: Full=CYPIA2; AltName: Full=Cytochrome P-448; AltName: Full=Cytochrome P-450d; AltName: Full=Cytochrome P450-D [Rattus norvegicus]

Related Sequences to LMP012397 proteins

Reference Database Accession Length Protein Name
GI:158186713 GenBank AAA41028.1 513 cytochrome p-450d [Rattus norvegicus]
GI:158186713 GenBank AAI27477.1 513 Cytochrome P450, family 1, subfamily a, polypeptide 2 [Rattus norvegicus]
GI:158186713 SwissProt P04799.2 513 RecName: Full=Cytochrome P450 1A2; AltName: Full=CYPIA2; AltName: Full=Cytochrome P-448; AltName: Full=Cytochrome P-450d; AltName: Full=Cytochrome P450-D [Rattus norvegicus]