Gene/Proteome Database (LMPD)
LMPD ID
LMP012400
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
NAD(P)H dehydrogenase, quinone 1
Gene Symbol
Synonyms
Dia4;
Alternate Names
NAD(P)H dehydrogenase [quinone] 1; DTD; QR1; azoreductase; DT-diaphorase; menadione reductase; quinone reductase 1; Diaphorase (NADH/NADPH); phylloquinone reductase; NAD(P)H:menadione oxidoreductase; NAD(P)H:quinone oxidoreductase 1;
Chromosome
19
Map Location
19q12
EC Number
1.6.5.2
Summary
enzyme that acts as an antioxidant; involved in increasing neuronal damage after injury [RGD, Feb 2006]
Orthologs
Proteins
NAD(P)H dehydrogenase [quinone] 1 | |
---|---|
Refseq ID | NP_058696 |
Protein GI | 27501444 |
UniProt ID | P05982 |
mRNA ID | NM_017000 |
Length | 274 |
MAVRRALIVLAHAERTSFNYAMKEAAVEALKKKGWEVVESDLYAMNFNPLISRNDITGEPKDSENFQYPVESSLAYKEGRLSPDIVAEQKKLEAADLVIFQFPLYWFGVPAILKGWFERVLVAGFAYTYATMYDKGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARVQVLEGWKKRLETVWEESPLYFAPSSLFDLNFQAGFLLKKEVQEEQKKNKFGLSVGHHLGKSIPADNQIKARK |
Gene Information
Entrez Gene ID
Gene Name
NAD(P)H dehydrogenase, quinone 1
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005829 | IDA:RGD | C | cytosol |
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0043025 | IDA:RGD | C | neuronal cell body |
GO:0003955 | IDA:RGD | F | NAD(P)H dehydrogenase (quinone) activity |
GO:0044822 | IEA:Ensembl | F | poly(A) RNA binding |
GO:0004784 | IMP:RGD | F | superoxide dismutase activity |
GO:0007568 | IEP:RGD | P | aging |
GO:0043086 | IEA:Ensembl | P | negative regulation of catalytic activity |
GO:0043525 | IMP:RGD | P | positive regulation of neuron apoptotic process |
GO:0019430 | IMP:GOC | P | removal of superoxide radicals |
GO:0032355 | IEP:RGD | P | response to estradiol |
GO:0045471 | IEP:RGD | P | response to ethanol |
GO:0007584 | IEP:RGD | P | response to nutrient |
GO:0014070 | IEP:RGD | P | response to organic cyclic compound |
GO:0006979 | IEP:RGD | P | response to oxidative stress |
GO:0006801 | IMP:RGD | P | superoxide metabolic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00130 | Ubiquinone and other terpenoid-quinone biosynthesis |
rno00130 | Ubiquinone and other terpenoid-quinone biosynthesis |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Biophysicochemical Properties | Kinetic parameters: KM=85 uM for NADH ; KM=39 uM for NADPH ; Note=kcat is 0.075 min(-1) NADH with as substrate. kcat is 0.074 min(-1) with NADPH as substrate ; |
Catalytic Activity | NAD(P)H + a quinone = NAD(P)(+) + a hydroquinone. {ECO:0000269|PubMed:1703398, ECO:0000269|PubMed:7862630}. |
Caution | PubMed:2480957 sequence seems incorrectly to be attributed to a mouse sequence while it really seems to correspond to the rat sequence |
Cofactor | Name=FAD; Xref=ChEBI:CHEBI:57692; Evidence= ; |
Function | The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinons involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis. {ECO:0000269|PubMed:1703398, ECO:0000269|PubMed:7862630}. |
Induction | By polycyclic hydrocarbons (Governed by the aromatic hydrocarbon-responsive (AH) locus). |
Miscellaneous | Quinone reductase accepts electrons from both NADH and NADPH with equal efficiency. |
Miscellaneous | This protein is inhibited by dicoumarol. |
Sequence Caution | Sequence=AAA41988.1; Type=Erroneous initiation; Evidence= ; |
Similarity | Belongs to the NAD(P)H dehydrogenase (quinone) family |
Subcellular Location | Cytoplasm . |
Subunit | Homodimer |
Identical and Related Proteins
Unique RefSeq proteins for LMP012400 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
27501444 | RefSeq | NP_058696 | 274 | NAD(P)H dehydrogenase [quinone] 1 |
Identical Sequences to LMP012400 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:27501444 | GenBank | AAA41989.1 | 274 | NAD(P)H:quinone reductase [Rattus norvegicus] |
GI:27501444 | GenBank | AAH83542.1 | 274 | NAD(P)H dehydrogenase, quinone 1 [Rattus norvegicus] |
GI:27501444 | GenBank | EDL92478.1 | 274 | NAD(P)H dehydrogenase, quinone 1 [Rattus norvegicus] |
GI:27501444 | PIR | - | 274 | NAD(P)H2 dehydrogenase (quinone) (EC 1.6.99.2) 1 [similarity] - mouse [Mus musculus] |
Related Sequences to LMP012400 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:27501444 | GenBank | AAA39829.1 | 274 | NAD(P)H oxidoreductase (EC 1.6.99.2) [Mus musculus] |
GI:27501444 | GenBank | AAA41715.1 | 274 | NAD(P)H:menadione oxidoreductase (EC 1.6.99.2) [Rattus norvegicus] |
GI:27501444 | SwissProt | P05982.4 | 274 | RecName: Full=NAD(P)H dehydrogenase [quinone] 1; AltName: Full=Azoreductase; AltName: Full=DT-diaphorase; Short=DTD; AltName: Full=Menadione reductase; AltName: Full=NAD(P)H:quinone oxidoreductase 1; AltName: Full=Phylloquinone reductase; AltName: Full=Quinone reductase 1; Short=QR1 [Rattus norvegicus] |