Gene/Proteome Database (LMPD)

LMPD ID
LMP012402
Gene ID
24360
Species
Rattus norvegicus (Rat)
Gene Name
fatty acid binding protein 1, liver
Gene Symbol
Fabp1
Synonyms
SCP; p14; SCP.; Fabplg; L-FABP;
Alternate Names
fatty acid-binding protein, liver; Z-protein; squalene- and sterol-carrier protein; liver-type fatty acid-binding protein;
Chromosome
4
Map Location
4q32
Summary
binds oleic acid and other hydrophobic ligands; may play a role in hepatocyte cell proliferation; may transport activated chemical carcinogens [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Fabp1

Proteins

fatty acid-binding protein, liver
Refseq ID NP_036688
Protein GI 6978825
UniProt ID P02692
mRNA ID NM_012556
Length 127
MNFSGKYQVQSQENFEPFMKAMGLPEDLIQKGKDIKGVSEIVHEGKKVKLTITYGSKVIHNEFTLGEECELETMTGEKVKAVVKMEGDNKMVTTFKGIKSVTEFNGDTITNTMTLGDIVYKRVSKRI

Gene Information

Entrez Gene ID
24360
Gene Name
fatty acid binding protein 1, liver
Gene Symbol
Fabp1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0045179 IDA:RGD C apical cortex
GO:0005737 IDA:RGD C cytoplasm
GO:0005829 IDA:RGD C cytosol
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005634 IDA:RGD C nucleus
GO:0005782 IDA:RGD C peroxisomal matrix
GO:0016209 IEA:Ensembl F antioxidant activity
GO:0032052 IMP:RGD F bile acid binding
GO:0003682 IEA:Ensembl F chromatin binding
GO:0008144 IPI:RGD F drug binding
GO:0005504 IDA:RGD F fatty acid binding
GO:0005324 IMP:RGD F long-chain fatty acid transporter activity
GO:0051978 IC:RGD F lysophospholipid transporter activity
GO:0005543 IMP:RGD F phospholipid binding
GO:0070301 IEA:Ensembl P cellular response to hydrogen peroxide
GO:0071456 IEA:Ensembl P cellular response to hypoxia
GO:0050892 IDA:RGD P intestinal absorption
GO:0015909 IMP:RGD P long-chain fatty acid transport
GO:0051977 IC:GOC P lysophospholipid transport
GO:0007067 TAS:RGD P mitotic nuclear division
GO:0043066 IEA:Ensembl P negative regulation of apoptotic process
GO:0043154 IEA:Ensembl P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0008284 IEP:RGD P positive regulation of cell proliferation
GO:0032000 IDA:RGD P positive regulation of fatty acid beta-oxidation
GO:0051345 IDA:RGD P positive regulation of hydrolase activity
GO:0006810 IEP:RGD P transport

KEGG Pathway Links

KEGG Pathway ID Description
ko04975 Fat digestion and absorption
rno04975 Fat digestion and absorption
ko03320 PPAR signaling pathway
rno03320 PPAR signaling pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
5953288 Fatty acid, triacylglycerol, and ketone body metabolism
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5954333 PPARA activates gene expression
5954222 Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha)

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding

UniProt Annotations

Entry Information

Gene Name
fatty acid binding protein 1, liver
Protein Entry
FABPL_RAT
UniProt ID
P02692
Species
Rat

Comments

Comment Type Description
Domain Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
Function Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport.
Interaction P22449:Hnf4a; NbExp=3; IntAct=EBI-1209448, EBI-5261592;
Miscellaneous There are three fractions of Z-protein: DE-I, DE-II and DE-III. DE-I is virtually lipid free, DE-II binds palmitic, stearic, oleic, linoleic and arachidonic acids and DE-III binds mainly arachidonic acid.
Ptm Deamidation and transpeptidation at the beta carboxyl of Asn- 105 forms an isoaspartyl residue found in an isoform of the DE-III fraction. This rearrangement gives rise to an extra negative charge carried by the acid form
Similarity Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family
Subcellular Location Cytoplasm.

Identical and Related Proteins

Unique RefSeq proteins for LMP012402 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6978825 RefSeq NP_036688 127 fatty acid-binding protein, liver

Identical Sequences to LMP012402 proteins

Reference Database Accession Length Protein Name
GI:6978825 GenBank EDL90984.1 127 fatty acid binding protein 1, liver [Rattus norvegicus]
GI:6978825 PDB 2JU3 127 Chain A, Solution-State Nmr Structures Of Apo-Lfabp (Liver Fatty Acid-Binding Protein)
GI:6978825 PDB 2JU7 127 Chain A, Solution-State Structures Of Oleate-Liganded Lfabp, Protein Only
GI:6978825 PDB 2JU8 127 Chain A, Solution-State Structures Of Oleate-Liganded Lfabp, Major Form Of 1:2 Protein-Ligand Complex

Related Sequences to LMP012402 proteins

Reference Database Accession Length Protein Name
GI:6978825 PDB 2JU3 127 Chain A, Solution-State Nmr Structures Of Apo-Lfabp (Liver Fatty Acid-Binding Protein)
GI:6978825 PDB 2JU7 127 Chain A, Solution-State Structures Of Oleate-Liganded Lfabp, Protein Only
GI:6978825 PDB 2JU8 127 Chain A, Solution-State Structures Of Oleate-Liganded Lfabp, Major Form Of 1:2 Protein-Ligand Complex