Gene/Proteome Database (LMPD)

LMPD ID
LMP012404
Gene ID
24390
Species
Rattus norvegicus (Rat)
Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1
Gene Symbol
B4galt1
Synonyms
Ggtb2;
Alternate Names
beta-1,4-galactosyltransferase 1; b4Gal-T1; beta4Gal-T1; beta-1,4-GalTase 1; Glycoprotein-4-beta-galactosyltransferase 2; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 1; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 1;
Chromosome
5
Map Location
5q22
Summary
plays a role in N-linked oligosaccharide biosynthesis [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for B4galt1

Proteins

beta-1,4-galactosyltransferase 1
Refseq ID NP_445739
Protein GI 158081739
UniProt ID G3V722
mRNA ID NM_053287
Length 399
MRFREPFLGGSAAMPGATLQRACRLLVAVCALHLGVTLVYYLSGRDLSRLPQLVGVSSSLQGGTNGAAASKQPSGELRPRGARPPPPLGVSPKPRPGSDSSPDAASGPGLKSNLTSVPMPTSTGLLTLPACPEESPLLVGPMVIDFNIPVDLELLAKKNPEIKMGGRYFPKDCISPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTMFNRAKLLNVGFQEALKDYDYNCFVFSDVDLIPMDDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVHKGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMRLDGLNSLTYQVLDIQRYPLYTKITVDIGTPR

Gene Information

Entrez Gene ID
24390
Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1
Gene Symbol
B4galt1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0000138 IEA:Ensembl C Golgi trans cisterna
GO:0016323 IEA:Ensembl C basolateral plasma membrane
GO:0031526 IEA:Ensembl C brush border membrane
GO:0030057 IEA:Ensembl C desmosome
GO:0009897 IEA:Ensembl C external side of plasma membrane
GO:0005615 IEA:Ensembl C extracellular space
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0030112 IEA:Ensembl C glycocalyx
GO:0003945 IEA:Ensembl F N-acetyllactosamine synthase activity
GO:0003831 IEA:Ensembl F beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity
GO:0004461 IEA:Ensembl F lactose synthase activity
GO:0030145 IEA:Ensembl F manganese ion binding
GO:0002526 IEA:Ensembl P acute inflammatory response
GO:0060055 IEA:Ensembl P angiogenesis involved in wound healing
GO:0007339 IEA:Ensembl P binding of sperm to zona pellucida
GO:0048754 IEA:Ensembl P branching morphogenesis of an epithelial tube
GO:0007155 IEA:Ensembl P cell adhesion
GO:0045136 IEA:Ensembl P development of secondary sexual characteristics
GO:0002064 IEA:Ensembl P epithelial cell development
GO:0030198 IEA:Ensembl P extracellular matrix organization
GO:0006012 IEA:Ensembl P galactose metabolic process
GO:0005989 IEA:Ensembl P lactose biosynthetic process
GO:0050900 IEA:Ensembl P leukocyte migration
GO:0030879 IEA:Ensembl P mammary gland development
GO:0008285 IEA:Ensembl P negative regulation of cell proliferation
GO:0007341 IEA:Ensembl P penetration of zona pellucida
GO:0060058 IEA:Ensembl P positive regulation of apoptotic process involved in mammary gland involution
GO:0060054 IEA:Ensembl P positive regulation of epithelial cell proliferation involved in wound healing
GO:0006487 IEA:Ensembl P protein N-linked glycosylation
GO:0060046 IEA:Ensembl P regulation of acrosome reaction
GO:0051270 IEA:Ensembl P regulation of cellular component movement

KEGG Pathway Links

KEGG Pathway ID Description
ko00052 Galactose metabolism
rno00052 Galactose metabolism
ko00533 Glycosaminoglycan biosynthesis - keratan sulfate
rno00533 Glycosaminoglycan biosynthesis - keratan sulfate
ko00601 Glycosphingolipid biosynthesis - lacto and neolacto series
rno00601 Glycosphingolipid biosynthesis - lacto and neolacto series
M00071 Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
rno01100 Metabolic pathways
ko00510 N-Glycan biosynthesis
rno00510 N-Glycan biosynthesis
M00075 N-glycan biosynthesis, complex type
ko00514 Other types of O-glycan biosynthesis
rno00514 Other types of O-glycan biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5953739 Asparagine N-linked glycosylation
5953253 Disease
5954442 Fertilization
5953252 Glycogen storage diseases
5953861 Glycosaminoglycan metabolism
5954445 Interaction With The Zona Pellucida
5954344 Keratan sulfate biosynthesis
5954345 Keratan sulfate/keratin metabolism
5953870 MPS I - Hurler syndrome
5953869 MPS II - Hunter syndrome
5953872 MPS IIIA - Sanfilippo syndrome A
5953864 MPS IIIB - Sanfilippo syndrome B
5953867 MPS IIIC - Sanfilippo syndrome C
5953871 MPS IIID - Sanfilippo syndrome D
5953866 MPS IV - Morquio syndrome A
5953873 MPS IV - Morquio syndrome B
5953862 MPS IX - Natowicz syndrome
5953865 MPS VI - Maroteaux-Lamy syndrome
5953868 MPS VII - Sly syndrome
5953250 Metabolism
5953249 Metabolism of carbohydrates
5953345 Metabolism of proteins
5953863 Mucopolysaccharidoses
5953251 Myoclonic epilepsy of Lafora
5954395 N-Glycan antennae elongation
5954394 N-glycan antennae elongation in the medial/trans-Golgi
5953728 Post-translational protein modification
5954523 Pre-NOTCH Expression and Processing
5954524 Pre-NOTCH Processing in Golgi
5954443 Reproduction
5953381 Signal Transduction
5953700 Signaling by NOTCH
5954050 Transport to the Golgi and subsequent modification

Domain Information

InterPro Annotations

Accession Description
IPR003859 Beta-1,4-galactosyltransferase
IPR027791 Galactosyltransferase, C-terminal
IPR027995 Galactosyltransferase, N-terminal
IPR029044 Nucleotide-diphospho-sugar transferases

UniProt Annotations

Entry Information

Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1
Protein Entry
G3V722_RAT
UniProt ID
G3V722
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP012404 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
158081739 RefSeq NP_445739 399 beta-1,4-galactosyltransferase 1

Identical Sequences to LMP012404 proteins

Reference Database Accession Length Protein Name
GI:158081739 GenBank EDL98643.1 399 UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1 (mapped), isoform CRA_a [Rattus norvegicus]

Related Sequences to LMP012404 proteins

Reference Database Accession Length Protein Name
GI:158081739 GenBank ABK42529.1 399 betaGlcNAc beta 1,4-galactosyltransferase [synthetic construct]
GI:158081739 GenBank EDL05427.1 399 UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1, isoform CRA_b [Mus musculus]
GI:158081739 GenBank EDL98643.1 399 UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1 (mapped), isoform CRA_a [Rattus norvegicus]