Gene/Proteome Database (LMPD)

LMPD ID
LMP012409
Gene ID
24465
Species
Rattus norvegicus (Rat)
Gene Name
hypoxanthine phosphoribosyltransferase 1
Gene Symbol
Hprt1
Synonyms
Hprt; Hgprtase;
Alternate Names
hypoxanthine-guanine phosphoribosyltransferase; HGPRT; hypoxanthine phosphoribosyl transferase; hypoxanthine guanine phosphoribosyl transferase 1;
Chromosome
X
Map Location
Xq36
EC Number
2.4.2.8;
Summary
catalyzes the conversion of IMP and diphosphate to hypoxanthine and 5-phospho-alpha-D-ribose 1-diphosphate [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Hprt1

Proteins

hypoxanthine-guanine phosphoribosyltransferase
Refseq ID NP_036715
Protein GI 51092266
UniProt ID P27605
mRNA ID NM_012583
Length 218
MSTLSPSVVISDDEPGYDLDLFCIPNHYAEDLEKVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVKQYSPKMVKVASLLVKRTSRSVGYRPDFVGFEIPDKFVVGYALDYNEHFRDLNHVCVISESGKAKYKA

Gene Information

Entrez Gene ID
24465
Gene Name
hypoxanthine phosphoribosyltransferase 1
Gene Symbol
Hprt1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IBA:RefGenome C cytosol
GO:0052657 ISS:UniProtKB F guanine phosphoribosyltransferase activity
GO:0004422 IDA:RGD F hypoxanthine phosphoribosyltransferase activity
GO:0000287 IBA:RefGenome F magnesium ion binding
GO:0000166 IEA:UniProtKB-KW F nucleotide binding
GO:0046038 ISS:UniProtKB P GMP catabolic process
GO:0032263 IBA:RefGenome P GMP salvage
GO:0046040 ISS:UniProtKB P IMP metabolic process
GO:0032264 IBA:RefGenome P IMP salvage
GO:0006168 IBA:RefGenome P adenine salvage
GO:0007420 IEP:RGD P brain development
GO:0032869 IEP:RGD P cellular response to insulin stimulus
GO:0006178 ISS:UniProtKB P guanine salvage
GO:0046100 IDA:RGD P hypoxanthine metabolic process
GO:0043103 ISS:UniProtKB P hypoxanthine salvage
GO:0006166 IBA:RefGenome P purine ribonucleoside salvage
GO:0007283 IEP:RGD P spermatogenesis

KEGG Pathway Links

KEGG Pathway ID Description
ko00983 Drug metabolism - other enzymes
rno00983 Drug metabolism - other enzymes
rno01100 Metabolic pathways
ko00230 Purine metabolism
rno00230 Purine metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
5953250 Metabolism
5953322 Metabolism of nucleotides
5953321 Purine metabolism
5953385 Purine salvage

Domain Information

InterPro Annotations

Accession Description
IPR005904 Hxn_phspho_trans
IPR000836 Phosphoribosyltransferase domain
IPR029057 Phosphoribosyltransferase-like

UniProt Annotations

Entry Information

Gene Name
hypoxanthine phosphoribosyltransferase 1
Protein Entry
HPRT_RAT
UniProt ID
P27605
Species
Rat

Comments

Comment Type Description
Catalytic Activity GMP + diphosphate = guanine + 5-phospho-alpha- D-ribose 1-diphosphate.
Catalytic Activity IMP + diphosphate = hypoxanthine + 5-phospho- alpha-D-ribose 1-diphosphate.
Cofactor Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence= ; Note=Binds 2 magnesium ions per subunit. The magnesium ions are essentially bound to the substrate and have few direct interactions with the protein. ;
Function Converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Transfers the 5- phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Plays a central role in the generation of purine nucleotides through the purine salvage pathway (By similarity)
Pathway Purine metabolism; IMP biosynthesis via salvage pathway; IMP from hypoxanthine: step 1/1.
Similarity Belongs to the purine/pyrimidine phosphoribosyltransferase family
Subcellular Location Cytoplasm.
Subunit Homotetramer

Identical and Related Proteins

Unique RefSeq proteins for LMP012409 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
51092266 RefSeq NP_036715 218 hypoxanthine-guanine phosphoribosyltransferase

Identical Sequences to LMP012409 proteins

Reference Database Accession Length Protein Name
GI:51092266 GenBank AAB65640.1 218 hypoxanthine guanine phosphoribosyl transferase [Rattus norvegicus]
GI:51092266 GenBank AAH98629.1 218 Hypoxanthine phosphoribosyltransferase 1 [Rattus norvegicus]
GI:51092266 GenBank EDL84492.1 218 rCG47045, isoform CRA_a [Rattus norvegicus]
GI:51092266 RefSeq XP_008771881.1 218 PREDICTED: hypoxanthine-guanine phosphoribosyltransferase [Rattus norvegicus]

Related Sequences to LMP012409 proteins

Reference Database Accession Length Protein Name
GI:51092266 EMBL CAA43997.1 218 rat hypoxanthine-guanine phosphoribosyltransferase, partial [Rattus norvegicus]
GI:51092266 GenBank EDL84492.1 218 rCG47045, isoform CRA_a [Rattus norvegicus]
GI:51092266 RefSeq XP_008771881.1 218 PREDICTED: hypoxanthine-guanine phosphoribosyltransferase [Rattus norvegicus]