Gene/Proteome Database (LMPD)
LMPD ID
LMP012409
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
hypoxanthine phosphoribosyltransferase 1
Gene Symbol
Synonyms
Hprt; Hgprtase;
Alternate Names
hypoxanthine-guanine phosphoribosyltransferase; HGPRT; hypoxanthine phosphoribosyl transferase; hypoxanthine guanine phosphoribosyl transferase 1;
Chromosome
X
Map Location
Xq36
EC Number
2.4.2.8;
Summary
catalyzes the conversion of IMP and diphosphate to hypoxanthine and 5-phospho-alpha-D-ribose 1-diphosphate [RGD, Feb 2006]
Orthologs
Proteins
| hypoxanthine-guanine phosphoribosyltransferase | |
|---|---|
| Refseq ID | NP_036715 |
| Protein GI | 51092266 |
| UniProt ID | P27605 |
| mRNA ID | NM_012583 |
| Length | 218 |
| MSTLSPSVVISDDEPGYDLDLFCIPNHYAEDLEKVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVKQYSPKMVKVASLLVKRTSRSVGYRPDFVGFEIPDKFVVGYALDYNEHFRDLNHVCVISESGKAKYKA | |
Gene Information
Entrez Gene ID
Gene Name
hypoxanthine phosphoribosyltransferase 1
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | IBA:RefGenome | C | cytosol |
| GO:0052657 | ISS:UniProtKB | F | guanine phosphoribosyltransferase activity |
| GO:0004422 | IDA:RGD | F | hypoxanthine phosphoribosyltransferase activity |
| GO:0000287 | IBA:RefGenome | F | magnesium ion binding |
| GO:0000166 | IEA:UniProtKB-KW | F | nucleotide binding |
| GO:0046038 | ISS:UniProtKB | P | GMP catabolic process |
| GO:0032263 | IBA:RefGenome | P | GMP salvage |
| GO:0046040 | ISS:UniProtKB | P | IMP metabolic process |
| GO:0032264 | IBA:RefGenome | P | IMP salvage |
| GO:0006168 | IBA:RefGenome | P | adenine salvage |
| GO:0007420 | IEP:RGD | P | brain development |
| GO:0032869 | IEP:RGD | P | cellular response to insulin stimulus |
| GO:0006178 | ISS:UniProtKB | P | guanine salvage |
| GO:0046100 | IDA:RGD | P | hypoxanthine metabolic process |
| GO:0043103 | ISS:UniProtKB | P | hypoxanthine salvage |
| GO:0006166 | IBA:RefGenome | P | purine ribonucleoside salvage |
| GO:0007283 | IEP:RGD | P | spermatogenesis |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00983 | Drug metabolism - other enzymes |
| rno00983 | Drug metabolism - other enzymes |
| rno01100 | Metabolic pathways |
| ko00230 | Purine metabolism |
| rno00230 | Purine metabolism |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
hypoxanthine phosphoribosyltransferase 1
Protein Entry
HPRT_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | GMP + diphosphate = guanine + 5-phospho-alpha- D-ribose 1-diphosphate. |
| Catalytic Activity | IMP + diphosphate = hypoxanthine + 5-phospho- alpha-D-ribose 1-diphosphate. |
| Cofactor | Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence= ; Note=Binds 2 magnesium ions per subunit. The magnesium ions are essentially bound to the substrate and have few direct interactions with the protein. ; |
| Function | Converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Transfers the 5- phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Plays a central role in the generation of purine nucleotides through the purine salvage pathway (By similarity) |
| Pathway | Purine metabolism; IMP biosynthesis via salvage pathway; IMP from hypoxanthine: step 1/1. |
| Similarity | Belongs to the purine/pyrimidine phosphoribosyltransferase family |
| Subcellular Location | Cytoplasm. |
| Subunit | Homotetramer |
Identical and Related Proteins
Unique RefSeq proteins for LMP012409 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 51092266 | RefSeq | NP_036715 | 218 | hypoxanthine-guanine phosphoribosyltransferase |
Identical Sequences to LMP012409 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:51092266 | GenBank | AAB65640.1 | 218 | hypoxanthine guanine phosphoribosyl transferase [Rattus norvegicus] |
| GI:51092266 | GenBank | AAH98629.1 | 218 | Hypoxanthine phosphoribosyltransferase 1 [Rattus norvegicus] |
| GI:51092266 | GenBank | EDL84492.1 | 218 | rCG47045, isoform CRA_a [Rattus norvegicus] |
| GI:51092266 | RefSeq | XP_008771881.1 | 218 | PREDICTED: hypoxanthine-guanine phosphoribosyltransferase [Rattus norvegicus] |
Related Sequences to LMP012409 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:51092266 | EMBL | CAA43997.1 | 218 | rat hypoxanthine-guanine phosphoribosyltransferase, partial [Rattus norvegicus] |
| GI:51092266 | GenBank | EDL84492.1 | 218 | rCG47045, isoform CRA_a [Rattus norvegicus] |
| GI:51092266 | RefSeq | XP_008771881.1 | 218 | PREDICTED: hypoxanthine-guanine phosphoribosyltransferase [Rattus norvegicus] |