Gene/Proteome Database (LMPD)

LMPD ID
LMP012430
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
retinol binding protein 2, cellular
Gene Symbol
Alternate Names
retinol-binding protein 2; CRBP-II; Retinol-binding protein 2 cellular; Retinol-binding protein 2, cellular; cellular retinol-binding protein II;
Chromosome
8
Map Location
8q31
Summary
expressed in neonatal interphotoreceptor matrix; may play a role in retinal development [RGD, Feb 2006]
Orthologs

Proteins

retinol-binding protein 2
Refseq ID NP_036772
Protein GI 78126163
UniProt ID P06768
mRNA ID NM_012640
Length 134
MTKDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKIIVQDGDNFKTKTNSTFRNYDLDFTVGVEFDEHTKGLDGRNVKTLVTWEGNTLVCVQKGEKENRGWKQWVEGDKLYLELTCGDQVCRQVFKKK

Gene Information

Entrez Gene ID
Gene Name
retinol binding protein 2, cellular
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IDA:RGD C cytosol
GO:0016918 IEA:UniProtKB-KW F retinal binding
GO:0019841 IDA:RGD F retinol binding
GO:0005215 IEA:InterPro F transporter activity
GO:0042572 TAS:RGD P retinol metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko04977 Vitamin digestion and absorption
rno04977 Vitamin digestion and absorption

REACTOME Pathway Links

REACTOME Pathway ID Description
5953253 Disease
5953382 Diseases associated with visual transduction
5954392 Retinoid metabolism and transport
5953381 Signal Transduction
5953380 Visual phototransduction

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding
IPR000566 Lipocalin/cytosolic fatty-acid binding domain

UniProt Annotations

Entry Information

Gene Name
retinol binding protein 2, cellular
Protein Entry
RET2_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Domain Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
Function Intracellular transport of retinol.
Similarity Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family
Subcellular Location Cytoplasm.

Identical and Related Proteins

Unique RefSeq proteins for LMP012430 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
78126163 RefSeq NP_036772 134 retinol-binding protein 2

Identical Sequences to LMP012430 proteins

Reference Database Accession Length Protein Name
GI:78126163 PDB 1OPB 134 Chain B, The Crystal Structures Of Holo-and Apo-cellular Retinol Binding Protein Ii
GI:78126163 PDB 1OPB 134 Chain C, The Crystal Structures Of Holo-and Apo-cellular Retinol Binding Protein Ii
GI:78126163 PDB 1OPB 134 Chain D, The Crystal Structures Of Holo-and Apo-cellular Retinol Binding Protein Ii
GI:78126163 RefSeq XP_006243669.1 134 PREDICTED: retinol-binding protein 2 isoform X1 [Rattus norvegicus]

Related Sequences to LMP012430 proteins

Reference Database Accession Length Protein Name
GI:78126163 GenBank AAA42022.1 134 cellular retinol-binding protein II [Rattus norvegicus]
GI:78126163 GenBank EDL77463.1 134 retinol binding protein 2, cellular, isoform CRA_a [Rattus norvegicus]
GI:78126163 SwissProt P06768.3 134 RecName: Full=Retinol-binding protein 2; AltName: Full=Cellular retinol-binding protein II; Short=CRBP-II [Rattus norvegicus]