Gene/Proteome Database (LMPD)

LMPD ID
LMP012432
Gene ID
24717
Species
Rattus norvegicus (Rat)
Gene Name
rhodopsin
Gene Symbol
Rho
Alternate Names
rhodopsin; Rhodopsin (retinitis pigmentosa 4, autosomal dominant);
Chromosome
4
Map Location
4q42
Summary
visual pigment protein of rod photoreceptors involved in G-protein coupled receptor mediated signaling and phototransduction [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Rho

Proteins

rhodopsin
Refseq ID NP_254276
Protein GI 15559213
UniProt ID P51489
mRNA ID NM_033441
Length 348
MNGTEGPNFYVPFSNITGVVRSPFEQPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIGLWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIFFLICWLPYASVAMYIFTHQGSNFGPIFMTLPAFFAKTASIYNPIIYIMMNKQFRNCMLTTLCCGKNPLGDDEASATASKTETSQVAPA

Gene Information

Entrez Gene ID
24717
Gene Name
rhodopsin
Gene Symbol
Rho
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:Ensembl C Golgi apparatus
GO:0005911 IEA:Ensembl C cell-cell junction
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0060342 ISS:UniProtKB C photoreceptor inner segment membrane
GO:0001750 IDA:RGD C photoreceptor outer segment
GO:0042622 ISS:UniProtKB C photoreceptor outer segment membrane
GO:0005886 ISS:UniProtKB C plasma membrane
GO:0030867 IDA:RGD C rough endoplasmic reticulum membrane
GO:0004930 IEA:UniProtKB-KW F G-protein coupled receptor activity
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0009881 IEA:UniProtKB-KW F photoreceptor activity
GO:0016918 IDA:RGD F retinal binding
GO:0030507 IDA:MGI F spectrin binding
GO:0006468 IEA:Ensembl P protein phosphorylation
GO:0018298 IEA:UniProtKB-KW P protein-chromophore linkage
GO:0009585 IDA:RGD P red, far-red light phototransduction
GO:0060041 IEA:Ensembl P retina development in camera-type eye
GO:0016056 IDA:RGD P rhodopsin mediated signaling pathway
GO:0007601 IEA:UniProtKB-KW P visual perception

KEGG Pathway Links

KEGG Pathway ID Description
ko04744 Phototransduction
rno04744 Phototransduction

REACTOME Pathway Links

REACTOME Pathway ID Description
5953383 Activation of the phototransduction cascade
5954122 Class A/1 (Rhodopsin-like receptors)
5953253 Disease
5953382 Diseases associated with visual transduction
5954152 G alpha (i) signalling events
5953642 GPCR downstream signaling
5953758 GPCR ligand binding
5953378 Inactivation, recovery and regulation of the phototransduction cascade
5954247 Opsins
5953381 Signal Transduction
5953391 Signaling by GPCR
5953384 The canonical retinoid cycle in rods (twilight vision)
5953379 The phototransduction cascade
5953380 Visual phototransduction

Domain Information

InterPro Annotations

Accession Description
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM
IPR001760 Opsin
IPR000732 Rhodopsin
IPR019477 Rhodopsin, N-terminal
IPR027430 Visual pigments (opsins) retinal binding site

UniProt Annotations

Entry Information

Gene Name
rhodopsin
Protein Entry
OPSD_RAT
UniProt ID
P51489
Species
Rat

Comments

Comment Type Description
Biophysicochemical Properties Absorption: Abs(max)=495 nm;
Function Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change leading to G-protein activation and release of all-trans retinal (By similarity)
Ptm Contains one covalently linked retinal chromophore
Ptm Phosphorylated on some or all of the serine and threonine residues present in the C-terminal region.
Similarity Belongs to the G-protein coupled receptor 1 family. Opsin subfamily
Subcellular Location Membrane; Multi-pass membrane protein. Note=Synthesized in the inner segment (IS) of rod photoreceptor cells before vectorial transport to the rod outer segment (OS) photosensory cilia
Subunit Homodimer
Tissue Specificity Rod shaped photoreceptor cells which mediates vision in dim light.

Identical and Related Proteins

Unique RefSeq proteins for LMP012432 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15559213 RefSeq NP_254276 348 rhodopsin

Identical Sequences to LMP012432 proteins

Reference Database Accession Length Protein Name
GI:15559213 EMBL CAA87081.1 348 rhodopsin [Rattus norvegicus]
GI:15559213 GenBank EDM02136.1 348 rhodopsin, isoform CRA_b [Rattus norvegicus]

Related Sequences to LMP012432 proteins

Reference Database Accession Length Protein Name
GI:15559213 EMBL CAA87081.1 348 rhodopsin [Rattus norvegicus]
GI:15559213 GenBank EDM02136.1 348 rhodopsin, isoform CRA_b [Rattus norvegicus]
GI:15559213 SwissProt P51489.1 348 RecName: Full=Rhodopsin [Rattus norvegicus]