Gene/Proteome Database (LMPD)
LMPD ID
LMP012438
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
synaptophysin
Gene Symbol
Synonyms
Syp1;
Alternate Names
synaptophysin; major synaptic vesicle protein p38;
Chromosome
X
Map Location
Xq13-q14
Summary
may play a role in synaptic vesicle organization and synaptic plasticity [RGD, Feb 2006]
Orthologs
Proteins
synaptophysin | |
---|---|
Refseq ID | NP_036796 |
Protein GI | 6981622 |
UniProt ID | P07825 |
mRNA ID | NM_012664 |
Length | 307 |
MDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYTGELRLSVECANKTESALNIEVEFEYPFRLHQVYFDAPSCVKGGTTKIFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMMDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPMCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFMRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPASGGGGYGPQGDYGQQGYGQQGAPTSFSNQM |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0030054 | IEA:UniProtKB-KW | C | cell junction |
GO:0060076 | IDA:BHF-UCL | C | excitatory synapse |
GO:0030285 | IBA:RefGenome | C | integral component of synaptic vesicle membrane |
GO:0043229 | IDA:RGD | C | intracellular organelle |
GO:0043005 | IDA:RGD | C | neuron projection |
GO:0044306 | IDA:RGD | C | neuron projection terminus |
GO:0048786 | IEA:Ensembl | C | presynaptic active zone |
GO:0042734 | IEA:Ensembl | C | presynaptic membrane |
GO:0043234 | IDA:RGD | C | protein complex |
GO:0008021 | IDA:ParkinsonsUK-UCL | C | synaptic vesicle |
GO:0015485 | IEA:Ensembl | F | cholesterol binding |
GO:0032403 | IPI:RGD | F | protein complex binding |
GO:0019904 | IPI:RGD | F | protein domain specific binding |
GO:0017075 | IDA:MGI | F | syntaxin-1 binding |
GO:0005215 | IEA:InterPro | F | transporter activity |
GO:0071310 | IEA:Ensembl | P | cellular response to organic substance |
GO:0006897 | IMP:UniProtKB | P | endocytosis |
GO:0048169 | IEA:Ensembl | P | regulation of long-term neuronal synaptic plasticity |
GO:0048168 | NAS:RGD | P | regulation of neuronal synaptic plasticity |
GO:2000474 | IDA:UniProtKB | P | regulation of opioid receptor signaling pathway |
GO:0048172 | IEA:Ensembl | P | regulation of short-term neuronal synaptic plasticity |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Domain | The calcium-binding activity is thought to be localized in the cytoplasmic tail of the protein. |
Function | Possibly involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane. Involved in the regulation of short-term and long-term synaptic plasticity (By similarity) |
Interaction | P33535:Oprm1; NbExp=8; IntAct=EBI-976085, EBI-4392569; Q9QWI6-2:Srcin1 (xeno); NbExp=2; IntAct=EBI-976085, EBI-775607; |
Ptm | Ubiquitinated; mediated by SIAH1 or SIAH2 and leading to its subsequent proteasomal degradation. |
Similarity | Belongs to the synaptophysin/synaptobrevin family |
Similarity | Contains 1 MARVEL domain. {ECO:0000255|PROSITE- ProRule:PRU00581}. |
Subcellular Location | Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein. Cell junction, synapse, synaptosome. |
Subunit | Homohexamer or homotetramer. Interacts with SRCIN1 (By similarity) |
Tissue Specificity | Characteristic of a type of small (30-80 nm) neurosecretory vesicles, including presynaptic vesicles, but also vesicles of various neuroendocrine cells of both neuronal and epithelial phenotype. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012438 (as displayed in Record Overview)
Identical Sequences to LMP012438 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6981622 | GenBank | AAA42196.1 | 307 | synaptophysin [Rattus norvegicus] |
GI:6981622 | GenBank | AAH99798.1 | 307 | Syp protein [Rattus norvegicus] |
GI:6981622 | GenBank | EDL83842.1 | 307 | synaptophysin, isoform CRA_a [Rattus norvegicus] |
GI:6981622 | GenBank | EDL83843.1 | 307 | synaptophysin, isoform CRA_a [Rattus norvegicus] |
Related Sequences to LMP012438 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6981622 | EMBL | CAA29543.1 | 307 | unnamed protein product [Rattus norvegicus] |
GI:6981622 | EMBL | CAA29685.1 | 307 | unnamed protein product [Rattus norvegicus] |
GI:6981622 | GenBank | AAH99798.1 | 307 | Syp protein [Rattus norvegicus] |