Gene/Proteome Database (LMPD)
LMPD ID
LMP012439
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
synaptotagmin II
Gene Symbol
Synonyms
SYNII; RATSYNII;
Alternate Names
synaptotagmin-2; sytII; synaptotagmin 2;
Chromosome
13
Map Location
13q13
Summary
component of synaptic vesicle membranes; may have important role in vesicle trafficking to the active zone of the synapse and in exocytosis; may be the crucial calcium sensor in neurotransmitter release [RGD, Feb 2006]
Orthologs
Proteins
synaptotagmin-2 | |
---|---|
Refseq ID | NP_036797 |
Protein GI | 6981624 |
UniProt ID | P29101 |
mRNA ID | NM_012665 |
Length | 422 |
MRNIFKRNQEPIVAPATTTATMPLAPAAPADNSTESTGTGESQEDMFAKLKDKFFNEINKIPLPPWALIAMAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0030054 | IEA:UniProtKB-KW | C | cell junction |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0030672 | TAS:RGD | C | synaptic vesicle membrane |
GO:0005509 | TAS:RGD | F | calcium ion binding |
GO:0005544 | IDA:BHF-UCL | F | calcium-dependent phospholipid binding |
GO:0019905 | IDA:BHF-UCL | F | syntaxin binding |
GO:0005215 | IEA:InterPro | F | transporter activity |
GO:0016079 | TAS:RGD | P | synaptic vesicle exocytosis |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Cofactor | Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence= ; Note=Binds 3 Ca(2+) ions per subunit. The ions are bound to the C2 domains. ; |
Domain | The first C2 domain mediates Ca(2+)-dependent phospholipid binding. |
Domain | The second C2 domain mediates interaction with Stonin 2 |
Function | May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. |
Interaction | P10844:botB (xeno); NbExp=3; IntAct=EBI-458017, EBI-7661991; Q9H4A3:WNK1 (xeno); NbExp=2; IntAct=EBI-458017, EBI-457907; Q9JIH7:Wnk1; NbExp=9; IntAct=EBI-458017, EBI-457953; |
Similarity | Belongs to the synaptotagmin family |
Similarity | Contains 2 C2 domains. {ECO:0000255|PROSITE- ProRule:PRU00041}. |
Subcellular Location | Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, chromaffin granule membrane; Single-pass membrane protein. Cytoplasm. Note=Synaptic vesicles and chromaffin granules. |
Subunit | Homotetramer (Probable). Interacts with SCAMP5 and stonin 2 (By similarity) |
Tissue Specificity | Predominantly expressed in phylogenetically older brain regions such as the spinal cord, brain stem and cerebellum. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012439 (as displayed in Record Overview)
Identical Sequences to LMP012439 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6981624 | GenBank | AAA63502.1 | 422 | synaptotagmin II [Rattus norvegicus] |
GI:6981624 | GenBank | AHH56805.1 | 422 | Sequence 9 from patent US 8617573 |
GI:6981624 | SwissProt | P29101.1 | 422 | RecName: Full=Synaptotagmin-2; AltName: Full=Synaptotagmin II; Short=SytII [Rattus norvegicus] |
Related Sequences to LMP012439 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6981624 | GenBank | AAA63502.1 | 422 | synaptotagmin II [Rattus norvegicus] |
GI:6981624 | GenBank | AHH56805.1 | 422 | Sequence 9 from patent US 8617573 |
GI:6981624 | SwissProt | P29101.1 | 422 | RecName: Full=Synaptotagmin-2; AltName: Full=Synaptotagmin II; Short=SytII [Rattus norvegicus] |