Gene/Proteome Database (LMPD)

LMPD ID
LMP012439
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
synaptotagmin II
Gene Symbol
Synonyms
SYNII; RATSYNII;
Alternate Names
synaptotagmin-2; sytII; synaptotagmin 2;
Chromosome
13
Map Location
13q13
Summary
component of synaptic vesicle membranes; may have important role in vesicle trafficking to the active zone of the synapse and in exocytosis; may be the crucial calcium sensor in neurotransmitter release [RGD, Feb 2006]
Orthologs

Proteins

synaptotagmin-2
Refseq ID NP_036797
Protein GI 6981624
UniProt ID P29101
mRNA ID NM_012665
Length 422
MRNIFKRNQEPIVAPATTTATMPLAPAAPADNSTESTGTGESQEDMFAKLKDKFFNEINKIPLPPWALIAMAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK

Gene Information

Entrez Gene ID
Gene Name
synaptotagmin II
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030054 IEA:UniProtKB-KW C cell junction
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0030672 TAS:RGD C synaptic vesicle membrane
GO:0005509 TAS:RGD F calcium ion binding
GO:0005544 IDA:BHF-UCL F calcium-dependent phospholipid binding
GO:0019905 IDA:BHF-UCL F syntaxin binding
GO:0005215 IEA:InterPro F transporter activity
GO:0016079 TAS:RGD P synaptic vesicle exocytosis

Domain Information

InterPro Annotations

Accession Description
IPR000008 C2 domain
IPR001565 Synaptotagmin

UniProt Annotations

Entry Information

Gene Name
synaptotagmin II
Protein Entry
SYT2_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Cofactor Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence= ; Note=Binds 3 Ca(2+) ions per subunit. The ions are bound to the C2 domains. ;
Domain The first C2 domain mediates Ca(2+)-dependent phospholipid binding.
Domain The second C2 domain mediates interaction with Stonin 2
Function May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone.
Interaction P10844:botB (xeno); NbExp=3; IntAct=EBI-458017, EBI-7661991; Q9H4A3:WNK1 (xeno); NbExp=2; IntAct=EBI-458017, EBI-457907; Q9JIH7:Wnk1; NbExp=9; IntAct=EBI-458017, EBI-457953;
Similarity Belongs to the synaptotagmin family
Similarity Contains 2 C2 domains. {ECO:0000255|PROSITE- ProRule:PRU00041}.
Subcellular Location Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, chromaffin granule membrane; Single-pass membrane protein. Cytoplasm. Note=Synaptic vesicles and chromaffin granules.
Subunit Homotetramer (Probable). Interacts with SCAMP5 and stonin 2 (By similarity)
Tissue Specificity Predominantly expressed in phylogenetically older brain regions such as the spinal cord, brain stem and cerebellum.

Identical and Related Proteins

Unique RefSeq proteins for LMP012439 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6981624 RefSeq NP_036797 422 synaptotagmin-2

Identical Sequences to LMP012439 proteins

Reference Database Accession Length Protein Name
GI:6981624 GenBank AAA63502.1 422 synaptotagmin II [Rattus norvegicus]
GI:6981624 GenBank AHH56805.1 422 Sequence 9 from patent US 8617573
GI:6981624 SwissProt P29101.1 422 RecName: Full=Synaptotagmin-2; AltName: Full=Synaptotagmin II; Short=SytII [Rattus norvegicus]

Related Sequences to LMP012439 proteins

Reference Database Accession Length Protein Name
GI:6981624 GenBank AAA63502.1 422 synaptotagmin II [Rattus norvegicus]
GI:6981624 GenBank AHH56805.1 422 Sequence 9 from patent US 8617573
GI:6981624 SwissProt P29101.1 422 RecName: Full=Synaptotagmin-2; AltName: Full=Synaptotagmin II; Short=SytII [Rattus norvegicus]