Gene/Proteome Database (LMPD)

LMPD ID
LMP012447
Gene ID
24896
Species
Rattus norvegicus (Rat)
Gene Name
GNAS complex locus
Gene Symbol
Gnas
Synonyms
Gnas1; Gnpas; Nesp55;
Alternate Names
GNAS; G-alpha-8; gnas {ECO:0000312|RGD:2716}; guanine nucleotide binding protein alpha s; adenylate cyclase-stimulating G alpha protein; guanine nucleotide-binding protein G-s, alpha subunit; GNAS (guanine nucleotide binding protein, alpha stimulating) complex locus;
Chromosome
3
Map Location
3q42
Summary
This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5' exons. Some transcripts contain a differentially methylated region (DMR) at their 5' exons, and this DMR is commonly found in imprinted genes and correlates with transcript expression. In addition, one of the transcripts contains a second overlapping ORF, which encodes a structurally unrelated protein - Alex. Alternative splicing of downstream exons is also observed, which results in different forms of the stimulatory G-protein alpha subunit, a key element of the classical signal transduction pathway linking receptor-ligand interactions with the activation of adenylyl cyclase and a variety of cellular reponses. Multiple transcript variants have been found for this gene. [provided by RefSeq, Apr 2009]
Orthologs
View orthologs and multiple alignments for Gnas

Proteins

ALEX isoform Alex
Refseq ID NP_001019994
Protein GI 253970437
UniProt ID B4F771
mRNA ID NM_001024823
Length 740
MSPSPTRLTVRSVDPLKTPNLTSRAPVRPSRKSKWAETTAHLQRKPCHSRSNSPAWEISGPPWSSLDHLGPHQASKPSTQRFWSPGPPLVHTQAWEPIAPHQKKLCHLSSMSLPRKTVASLPCKSQTLRQGVRKHGSPELFPRSPGTSDLKTLASEKTTALHLKNLCHFSSMEKNSGAIAHPQDSRESRHKSALAASSRQSRSRVRSASLPPRTRLPSGSRAPLADHSARLSDLLTSHTTFPQWRSPDPCLRLAEPPLGSTTTPLSIWTAPQSQVMARPSKSREPQLRASTQRDPHLSDKQPRQETALSAAPLQRRQKSPPSSEEKDPPPNLKQCISSQLLLRSPERTLPKPIRTQLHTQFFRSVLRKSEESQPCPPIFRLLLKMRAQMSGQNQTEGQPQPPLPSPKTTENQPPPPPPSQPPSQPLSQPPSQPPSQPPSQLPRQSLTPKPSLPPGQSPTPKRSPQPRQPLPRRRSLPPGQPPSPLRSPLPGLSLLPEPIQPPGLSLEPQRCQPLLGQPPLEQPMQVLWSGEPGHSRLLQPLGHPSLPAQQLPPEQPLLPAQSLPAGQPLPPQAGPILDPPARRSRLLTRLLRGLLRGRVPGLTNTNVAEAAAGMRLRPASARSSPPAMSRKKGPLAASSGFCGETAALASPGATQSGATRSATSSPEPSEAASVYLSVPDHDPSAPGRPRILWKRGANRCAKKPWRCESRSAQIRNAASSSTSNWRRRRWTTCVHTACCF
GNAS isoform GNASL
Refseq ID NP_062005
Protein GI 9506737
UniProt ID P63095
mRNA ID NM_019132
Length 394
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPNFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
GNAS isoform XLas
Refseq ID NP_068617
Protein GI 253970435
UniProt ID B4F771
mRNA ID NM_021845
Length 1144
MGMLNCLHGNNMSGQHDIPPEVGDQPEQEPLEAQGAAAPGAGVGPAEEMETEPSNNEPIPDETDSEVCGPPEDSKSDIQSPSQAFEEVQVGGDYSPPPEEAMPFEIQQPSLGDFWPTLEQPGPSGTPSGIKAFNPAILEPGTPTGAHPGLGAYSPPPEEAMPFEFNEPAQEDRCQPPLQVPDLAPGGPEAWVSRALPAEPGNLGFENTGFREDYSPPPEESVPFQLDGEEFGGDSPPPGLPRVTPQIGIGGEFPTVAVPSTLCLAPAANAPPLWVQGAIGRPFREAVRSPNFAYDISPMEITRPLLEIGRASTGVDDDTAVNMDSPPIASDGPPIEVSGAPVKSEHAKRPPLERQAAETGNSPISSTTAEEAKVPSLERGEGSPTQPETVHIKPAPVAESGTDSSKADPDSATHAVLQIGPEEVGGVPTMPTDLPPASEDAGPDVRAEPDGGTAPATPAESEDNREPAAAAAAEPAAEPAAEPAAEPAAEPAAEPAAEAVPDTEAESASGAVPDTQEEPAAAAASATPAEPAARAAPVTPTEPATRAVPSARAHPAAGAVPGASAMSAAARAAAARAAYAGPLVWGARSLSATPAARASLPARAAAAARAASAARAVAAGRSASAAPSRAHLRPPSPEIQVADPPTPRPAPRPSAWPDKYERGRSCCRYEAASGICEIESSSDESEEGATGCFQWLLRRNRRPGQPRSHTVGSNPVRNFFARAFGSCFGLSECTRSRSLSPGKAKDPMEERRKQMRKEAMEMREQKRADKKRSKLIDKQLEEEKMDYMCTHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPNFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
NESP55 isoform NESP55
Refseq ID NP_001153125
Protein GI 228008388
UniProt ID Q792G6
mRNA ID NM_001159653
Length 256
MDRRSRAHQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALASSNARAQQRAAQRRSFLNAHHRSAAAAAAAQVLPESSESESDHEHEEAEPELARPECLEYDQDDYETETDSETEPESDIQSETEFETEPETEPETAPTTEPETEPEDERGPRGATFNQSLTQRLHALKLQSADASPRRAQPTTQEPESASEGEEPQREPLDEDPRDPEESEELREANRQPRRCKTRRPARRRDQSPESPPRKGPIPIRRH
NESP55 isoform NESP55
Refseq ID NP_001153128
Protein GI 228008390
UniProt ID Q792G6
mRNA ID NM_001159656
Length 256
Protein sequence is identical to GI:228008388 (mRNA isoform)

Gene Information

Entrez Gene ID
24896
Gene Name
GNAS complex locus
Gene Symbol
Gnas
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030054 IEA:UniProtKB-KW C cell junction
GO:0005737 IDA:RGD C cytoplasm
GO:0031410 IEA:UniProtKB-KW C cytoplasmic vesicle
GO:0005829 IDA:RGD C cytosol
GO:0005768 IDA:RGD C endosome
GO:0005576 IEA:UniProtKB-KW C extracellular region
GO:0005834 IDA:RGD C heterotrimeric G-protein complex
GO:0016020 IDA:RGD C membrane
GO:0045121 IDA:RGD C membrane raft
GO:0005886 IDA:RGD C plasma membrane
GO:0001726 IDA:RGD C ruffle
GO:0045202 IEA:UniProtKB-KW C synapse
GO:0031982 IDA:RGD C vesicle
GO:0043014 IDA:RGD F alpha-tubulin binding
GO:0031698 IPI:RGD F beta-2 adrenergic receptor binding
GO:0051430 IPI:RGD F corticotropin-releasing hormone receptor 1 binding
GO:0031748 IPI:RGD F D1 dopamine receptor binding
GO:0001965 IPI:RGD F G-protein alpha-subunit binding
GO:0031683 IBA:RefGenome F G-protein beta/gamma-subunit complex binding
GO:0031681 IDA:RGD F G-protein beta-subunit binding
GO:0003924 IBA:RefGenome F GTPase activity
GO:0005525 IDA:RGD F GTP binding
GO:0005159 IPI:RGD F insulin-like growth factor receptor binding
GO:0035255 IPI:RGD F ionotropic glutamate receptor binding
GO:0031852 IDA:RGD F mu-type opioid receptor binding
GO:0019904 IPI:RGD F protein domain specific binding
GO:0004871 IDA:RGD F signal transducer activity
GO:0007189 IDA:RGD P adenylate cyclase-activating G-protein coupled receptor signaling pathway
GO:0055074 IMP:RGD P calcium ion homeostasis
GO:0007186 IMP:RGD P G-protein coupled receptor signaling pathway
GO:0006184 IBA:GOC P GTP catabolic process
GO:0045776 IMP:RGD P negative regulation of blood pressure
GO:0035814 IMP:RGD P negative regulation of renal sodium excretion
GO:0030819 IMP:RGD P positive regulation of cAMP biosynthetic process
GO:0001934 IMP:RGD P positive regulation of protein phosphorylation
GO:0010765 IMP:RGD P positive regulation of sodium ion transport
GO:0006357 IMP:RGD P regulation of transcription from RNA polymerase II promoter
GO:0007606 IBA:RefGenome P sensory perception of chemical stimulus

KEGG Pathway Links

KEGG Pathway ID Description
ko04261 Adrenergic signaling in cardiomyocytes
rno04261 Adrenergic signaling in cardiomyocytes
ko05034 Alcoholism
rno05034 Alcoholism
ko05146 Amoebiasis
rno05146 Amoebiasis
ko05031 Amphetamine addiction
rno05031 Amphetamine addiction
ko04976 Bile secretion
rno04976 Bile secretion
ko04020 Calcium signaling pathway
rno04020 Calcium signaling pathway
ko04024 cAMP signaling pathway
rno04024 cAMP signaling pathway
ko05142 Chagas disease (American trypanosomiasis)
rno05142 Chagas disease (American trypanosomiasis)
ko04713 Circadian entrainment
rno04713 Circadian entrainment
ko05030 Cocaine addiction
rno05030 Cocaine addiction
ko05414 Dilated cardiomyopathy
rno05414 Dilated cardiomyopathy
ko04728 Dopaminergic synapse
rno04728 Dopaminergic synapse
ko04961 Endocrine and other factor-regulated calcium reabsorption
rno04961 Endocrine and other factor-regulated calcium reabsorption
ko04915 Estrogen signaling pathway
rno04915 Estrogen signaling pathway
ko04540 Gap junction
rno04540 Gap junction
ko04971 Gastric acid secretion
rno04971 Gastric acid secretion
ko04724 Glutamatergic synapse
rno04724 Glutamatergic synapse
ko04912 GnRH signaling pathway
rno04912 GnRH signaling pathway
ko04750 Inflammatory mediator regulation of TRP channels
rno04750 Inflammatory mediator regulation of TRP channels
rno04911 Insulin secretion
ko04730 Long-term depression
rno04730 Long-term depression
ko04916 Melanogenesis
rno04916 Melanogenesis
ko05032 Morphine addiction
rno05032 Morphine addiction
ko04913 Ovarian steroidogenesis
rno04913 Ovarian steroidogenesis
ko04921 Oxytocin signaling pathway
rno04921 Oxytocin signaling pathway
ko04972 Pancreatic secretion
rno04972 Pancreatic secretion
rno04611 Platelet activation
ko04015 Rap1 signaling pathway
rno04015 Rap1 signaling pathway
ko04970 Salivary secretion
rno04970 Salivary secretion
rno04726 Serotonergic synapse
ko04742 Taste transduction
rno04742 Taste transduction
ko04918 Thyroid hormone synthesis
rno04918 Thyroid hormone synthesis
ko04270 Vascular smooth muscle contraction
rno04270 Vascular smooth muscle contraction
ko04962 Vasopressin-regulated water reabsorption
rno04962 Vasopressin-regulated water reabsorption

Domain Information

InterPro Annotations

Accession Description
IPR009434 Neuroendocrine-specific golgi P55

UniProt Annotations

Entry Information

Gene Name
GNAS complex locus
Protein Entry
GNAS3_RAT
UniProt ID
Q792G6
Species
Rat

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=5; Name=Nesp55 ; IsoId=Q792G6-1; Sequence=Displayed; Note=Shares no sequence similarity with other isoforms due to a novel first exon containing the entire reading frame spliced to shared exon 2 so that exons 2-13 make up the 3'-UTR.; Name=XLas-1; IsoId=Q63803-1; Sequence=External; Name=Gnas-1 ; IsoId=P63095-1; Sequence=External; Name=Gnas-2 ; IsoId=P63095-2; Sequence=External; Name=Gnas-3 {ECO:0000305}; Synonyms=GsaN1 ; IsoId=P63095-3; Sequence=External;
Miscellaneous The GNAS locus is imprinted in a complex manner, giving rise to distinct paternally, maternally and biallelically expressed proteins. The XLas isoforms are paternally derived, the Gnas isoforms are biallelically derived and the Nesp55 isoforms are maternally derived.
Ptm Binds keratan sulfate chains
Ptm May be proteolytically processed to give rise to a number of active peptides
Similarity Belongs to the NESP55 family
Subcellular Location Cytoplasmic vesicle, secretory vesicle, synaptic vesicle {ECO:0000250}. Secreted . Note=Neuroendocrine secretory granules

Identical and Related Proteins

Unique RefSeq proteins for LMP012447 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
253970437 RefSeq NP_001019994 740 ALEX isoform Alex
9506737 RefSeq NP_062005 394 GNAS isoform GNASL
253970435 RefSeq NP_068617 1144 GNAS isoform XLas
228008388 RefSeq NP_001153125 256 NESP55 isoform NESP55

Identical Sequences to LMP012447 proteins

Reference Database Accession Length Protein Name
GI:9506737 GenBank EDL06667.1 394 mCG126326, isoform CRA_a [Mus musculus]
GI:228008388 GenBank EDL85091.1 256 rCG40874, isoform CRA_c [Rattus norvegicus]
GI:228008390 GenBank EDL85091.1 256 rCG40874, isoform CRA_c [Rattus norvegicus]
GI:9506737 GenBank AAI58590.1 394 GNAS complex locus [Rattus norvegicus]
GI:228008390 RefSeq NP_001153125.1 256 NESP55 isoform NESP55 [Rattus norvegicus]
GI:228008388 RefSeq NP_001153128.1 256 NESP55 isoform NESP55 [Rattus norvegicus]
GI:9506737 RefSeq NP_001268870.1 394 guanine nucleotide-binding protein G(s) subunit alpha [Mesocricetus auratus]
GI:9506737 RefSeq XP_006498838.1 394 PREDICTED: protein ALEX isoform X2 [Mus musculus]

Related Sequences to LMP012447 proteins

Reference Database Accession Length Protein Name
GI:253970437 GenBank AAD03033.1 738 unknown [Rattus norvegicus]
GI:228008388 GenBank AAD11801.1 256 neuroendocrine-specific Golgi protein p55 [Rattus norvegicus]
GI:228008390 GenBank AAD11801.1 256 neuroendocrine-specific Golgi protein p55 [Rattus norvegicus]
GI:9506737 GenBank AAH38067.1 394 Gnas protein [Mus musculus]
GI:9506737 GenBank AAN93812.1 394 Sequence 106 from patent US 6462178
GI:253970437 GenBank AAS00602.1 725 alex-extended [Mus musculus]
GI:228008390 GenBank EDL85091.1 256 rCG40874, isoform CRA_c [Rattus norvegicus]
GI:228008388 GenBank EDL85091.1 256 rCG40874, isoform CRA_c [Rattus norvegicus]
GI:253970435 RefSeq NP_034439.2 1133 protein GNAS isoform XLas [Mus musculus]
GI:9506737 RefSeq NP_963910.1 394 protein GNAS isoform GNASL [Mus musculus]
GI:228008390 RefSeq NP_001153125.1 256 NESP55 isoform NESP55 [Rattus norvegicus]
GI:228008388 RefSeq NP_001153128.1 256 NESP55 isoform NESP55 [Rattus norvegicus]
GI:253970437 SwissProt Q9Z213.1 738 RecName: Full=Protein ALEX; AltName: Full=Alternative gene product encoded by XL-exon [Rattus norvegicus]
GI:253970435 SwissProt Q6R0H7.1 1133 RecName: Full=Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas; AltName: Full=Adenylate cyclase-stimulating G alpha protein; AltName: Full=Extra large alphas protein; Short=XLalphas [Mus musculus]
GI:253970435 SwissProt Q63803.3 1144 RecName: Full=Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas; AltName: Full=Adenylate cyclase-stimulating G alpha protein; AltName: Full=Extra large alphas protein; Short=XLalphas; AltName: Full=G-alpha-8 [Rattus norvegicus]