Gene/Proteome Database (LMPD)

LMPD ID
LMP012449
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
phospholipase A2, group XVI
Gene Symbol
Synonyms
HRSL3; Hrasls3; Hrev107;
Alternate Names
HRAS-like suppressor 3; H-rev 107 protein; HRAS like suppressor 3; group XVI phospholipase A2; group XVI phospholipase A1/A2; Hras-revertant gene 107 (expression down-regulated in HRAS-transformed rat 208F fibroblasts);
Chromosome
1
Map Location
1q43
EC Number
3.1.1.32
Summary
gene whose expression is suppressed by HRAS [RGD, Feb 2006]
Orthologs

Proteins

HRAS-like suppressor 3
Refseq ID NP_058756
Protein GI 126723733
UniProt ID P53817
mRNA ID NM_017060
Length 160
MPIPEPKPGDLIEIFRPMYSHWAIYVGDGYVIHLAPPSEIPGAGAASIMSALTDKAIVKKELLRDVAGKDKYQVNNKHDKEYTPLPLNKIIQRAEELVGQEVLYRLTSENCEHFVNELRYGVPRSDQVRDAVKVATVTGVGLAALGLIGVMLSRNKKQKQ

Gene Information

Entrez Gene ID
Gene Name
phospholipase A2, group XVI
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:RGD C cytoplasm
GO:0005783 IEA:Ensembl C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016020 IDA:RGD C membrane
GO:0048471 IEA:Ensembl C perinuclear region of cytoplasm
GO:0052740 IEA:UniProtKB-EC F 1-acyl-2-lysophosphatidylserine acylhydrolase activity
GO:0008970 IEA:UniProtKB-EC F phosphatidylcholine 1-acylhydrolase activity
GO:0052739 IEA:UniProtKB-EC F phosphatidylserine 1-acylhydrolase activity
GO:0004623 IEA:UniProtKB-EC F phospholipase A2 activity
GO:0016042 IEA:UniProtKB-KW P lipid catabolic process
GO:0045786 IMP:RGD P negative regulation of cell cycle
GO:0008654 IEA:Ensembl P phospholipid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00590 Arachidonic acid metabolism
rno00590 Arachidonic acid metabolism
ko00565 Ether lipid metabolism
rno00565 Ether lipid metabolism
ko00564 Glycerophospholipid metabolism
rno00564 Glycerophospholipid metabolism
ko00591 Linoleic acid metabolism
rno00591 Linoleic acid metabolism
rno01100 Metabolic pathways
rno04014 Ras signaling pathway
ko00592 alpha-Linolenic acid metabolism
rno00592 alpha-Linolenic acid metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
5954464 Acyl chain remodelling of PC
5954471 Acyl chain remodelling of PE
5954468 Acyl chain remodelling of PI
5954470 Acyl chain remodelling of PS
5953473 Glycerophospholipid biosynthesis
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5953474 Phospholipid metabolism

Domain Information

InterPro Annotations

Accession Description
IPR007053 LRAT-like domain

UniProt Annotations

Entry Information

Gene Name
phospholipase A2, group XVI
Protein Entry
HRSL3_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate.
Catalytic Activity Phosphatidylcholine + H(2)O = 2- acylglycerophosphocholine + a carboxylate.
Function Exhibits PLA1/2 activity, catalyzing the calcium- independent hydrolysis of acyl groups in various phosphotidylcholines (PC) and phosphatidylethanolamine (PE). For most substrates, PLA1 activity is much higher than PLA2 activity. Specifically catalyzes the release of fatty acids from phospholipids in adipose tissue. N- and O-acylation activity is hardly detectable. Also has weak lysophospholipase activity (By similarity)
Induction Induced during preadipocyte differentiation into adipocytes
Similarity Belongs to the H-rev107 family
Subcellular Location Cytoplasm . Cytoplasm, perinuclear region . Membrane ; Single-pass membrane protein .
Subunit Interacts with PPP2R1A; this interaction might decrease PP2A activity
Tissue Specificity Specifically expressed in H-ras resistant fibroblasts. {ECO:0000269|PubMed:18614531, ECO:0000269|PubMed:8290259}.

Identical and Related Proteins

Unique RefSeq proteins for LMP012449 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
126723733 RefSeq NP_058756 160 HRAS-like suppressor 3

Identical Sequences to LMP012449 proteins

Reference Database Accession Length Protein Name
GI:126723733 DBBJ BAH08634.1 160 rat LRAT-like protein 3 [Rattus norvegicus]
GI:126723733 GenBank EDM12684.1 160 rCG47447, isoform CRA_a [Rattus norvegicus]
GI:126723733 GenBank EDM12685.1 160 rCG47447, isoform CRA_a [Rattus norvegicus]
GI:126723733 SwissProt P53817.2 160 RecName: Full=HRAS-like suppressor 3; Short=HRSL3; AltName: Full=Group XVI phospholipase A1/A2; AltName: Full=H-rev 107 protein [Rattus norvegicus]

Related Sequences to LMP012449 proteins

Reference Database Accession Length Protein Name
GI:126723733 DBBJ BAH08634.1 160 rat LRAT-like protein 3 [Rattus norvegicus]
GI:126723733 GenBank EDM12684.1 160 rCG47447, isoform CRA_a [Rattus norvegicus]
GI:126723733 SwissProt P53817.2 160 RecName: Full=HRAS-like suppressor 3; Short=HRSL3; AltName: Full=Group XVI phospholipase A1/A2; AltName: Full=H-rev 107 protein [Rattus norvegicus]