Gene/Proteome Database (LMPD)

LMPD ID
LMP012453
Gene ID
24943
Species
Rattus norvegicus (Rat)
Gene Name
proteolipid protein 1
Gene Symbol
Plp1
Synonyms
Plp;
Alternate Names
myelin proteolipid protein; lipophilin; proteolipid protein (myelin) 1; Proteolipid protein (Pelizaeus-Merzbacher disease spastic paraplegia 2 uncomplicated); Proteolipid protein (Pelizaeus-Merzbacher disease, spastic paraplegia 2, uncomplicated);
Chromosome
X
Map Location
Xq35

Proteins

myelin proteolipid protein
Refseq ID NP_112252
Protein GI 13591880
UniProt ID P60203
mRNA ID NM_030990
Length 277
MGLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF

Gene Information

Entrez Gene ID
24943
Gene Name
proteolipid protein 1
Gene Symbol
Plp1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005887 TAS:RGD C integral component of plasma membrane
GO:0043209 IEA:Ensembl C myelin sheath
GO:0005886 ISS:UniProtKB C plasma membrane
GO:0019911 IMP:RGD F structural constituent of myelin sheath
GO:0005198 IDA:RGD F structural molecule activity
GO:0014002 IEA:Ensembl P astrocyte development
GO:0061564 IEA:Ensembl P axon development
GO:0008366 IEP:RGD P axon ensheathment
GO:0048469 IEA:Ensembl P cell maturation
GO:0022010 IEA:Ensembl P central nervous system myelination
GO:0010001 IMP:RGD P glial cell differentiation
GO:0006954 IEA:Ensembl P inflammatory response
GO:0007229 IPI:RGD P integrin-mediated signaling pathway
GO:0042759 IEA:Ensembl P long-chain fatty acid biosynthetic process
GO:0042552 IMP:RGD P myelination
GO:0010628 IEA:Ensembl P positive regulation of gene expression
GO:0021762 IEA:Ensembl P substantia nigra development

Domain Information

InterPro Annotations

Accession Description
IPR001614 Myelin proteolipid protein PLP
IPR018237 Myelin proteolipid protein PLP, conserved site

UniProt Annotations

Entry Information

Gene Name
proteolipid protein 1
Protein Entry
MYPR_RAT
UniProt ID
P60203
Species
Rat

Comments

Comment Type Description
Disease Note=Defects in Plp1 are the causee of the dysmyelinating disease MD.
Function This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin.
Similarity Belongs to the myelin proteolipid protein family
Subcellular Location Cell membrane; Multi-pass membrane protein. Myelin membrane . Note=Colocalizes with SIRT2 in internodal regions, at paranodal axoglial junction and Schmidt- Lanterman incisures of myelin sheat

Identical and Related Proteins

Unique RefSeq proteins for LMP012453 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13591880 RefSeq NP_112252 277 myelin proteolipid protein

Identical Sequences to LMP012453 proteins

Reference Database Accession Length Protein Name
GI:13591880 RefSeq XP_008971308.1 277 PREDICTED: myelin proteolipid protein isoform X1 [Pan paniscus]
GI:13591880 RefSeq XP_008971309.1 277 PREDICTED: myelin proteolipid protein isoform X1 [Pan paniscus]
GI:13591880 RefSeq XP_008971310.1 277 PREDICTED: myelin proteolipid protein isoform X1 [Pan paniscus]
GI:13591880 RefSeq XP_009233351.1 277 PREDICTED: myelin proteolipid protein isoform X1 [Pongo abelii]

Related Sequences to LMP012453 proteins

Reference Database Accession Length Protein Name
GI:13591880 DBBJ BAG10260.1 277 myelin proteolipid protein, partial [synthetic construct]
GI:13591880 GenBank ABJ47074.1 277 Sequence 7813 from patent US 7115416
GI:13591880 RefSeq XP_004643411.1 277 PREDICTED: myelin proteolipid protein isoform X1 [Octodon degus]