Gene/Proteome Database (LMPD)

LMPD ID
LMP012454
Gene ID
24950
Species
Rattus norvegicus (Rat)
Gene Name
steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)
Gene Symbol
Srd5a1
Synonyms
S5AR 1;
Alternate Names
3-oxo-5-alpha-steroid 4-dehydrogenase 1; SR type 1; steroid 5 alpha-reductase 1; steroid 5-alpha-reductase 1; steroid-5-alpha-reductase 1;
Chromosome
17
Map Location
17p14
EC Number
1.3.1.22
Summary
catalyzes the conversion of testosterone to dihydrotestosterone; required for male sex differentiation [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Srd5a1

Proteins

3-oxo-5-alpha-steroid 4-dehydrogenase 1
Refseq ID NP_058766
Protein GI 77404421
UniProt ID P24008
mRNA ID NM_017070
Length 255
MELDELCLLDMLVYLEGFMAFVSIVGLRSVGSPYGRYSPQWPGIRVPARPAWFIQELPSMAWPLYEYIRPAAARLGNLPNRVLLAMFLIHYVQRTLVFPVLIRGGKPTLLVTFVLAFLFCTFNGYVQSRYLSQFAVYAEDWVTHPCFLTGFALWLVGMVINIHSDHILRNLRKPGETGYKIPRGGLFEYVSAANYFGELVEWCGFALASWSLQGVVFALFTLSTLLTRAKQHHQWYHEKFEDYPKSRKILIPFVL

Gene Information

Entrez Gene ID
24950
Gene Name
steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)
Gene Symbol
Srd5a1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070852 IDA:RGD C cell body fiber
GO:0005737 IDA:RGD C cytoplasm
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0043231 IDA:RGD C intracellular membrane-bounded organelle
GO:0043209 IDA:RGD C myelin sheath
GO:0043025 IDA:RGD C neuronal cell body
GO:0048471 IDA:RGD C perinuclear region of cytoplasm
GO:0003865 ISS:UniProtKB F 3-oxo-5-alpha-steroid 4-dehydrogenase activity
GO:0070402 IDA:RGD F NADPH binding
GO:0033218 IDA:RGD F amide binding
GO:0047751 IEA:UniProtKB-EC F cholestenone 5-alpha-reductase activity
GO:0006702 IDA:RGD P androgen biosynthetic process
GO:0008209 IDA:RGD P androgen metabolic process
GO:0060348 IEP:RGD P bone development
GO:0030154 IEA:UniProtKB-KW P cell differentiation
GO:0071320 IEP:RGD P cellular response to cAMP
GO:0071549 IEP:RGD P cellular response to dexamethasone stimulus
GO:0071872 IEP:RGD P cellular response to epinephrine stimulus
GO:0071392 IEP:RGD P cellular response to estradiol stimulus
GO:0071363 IEP:RGD P cellular response to growth factor stimulus
GO:0032869 IEP:RGD P cellular response to insulin stimulus
GO:0071407 IEP:RGD P cellular response to organic cyclic compound
GO:0009267 IEP:RGD P cellular response to starvation
GO:0071394 IEP:RGD P cellular response to testosterone stimulus
GO:0021987 IEP:RGD P cerebral cortex development
GO:0042747 IEP:RGD P circadian sleep/wake cycle, REM sleep
GO:0016101 IEP:RGD P diterpenoid metabolic process
GO:0030540 IEP:RGD P female genitalia development
GO:0021766 IEP:RGD P hippocampus development
GO:0021854 IEP:RGD P hypothalamus development
GO:0001889 IEP:RGD P liver development
GO:0030539 IEP:RGD P male genitalia development
GO:0008584 IEP:RGD P male gonad development
GO:0046661 TAS:RGD P male sex differentiation
GO:0021983 IEP:RGD P pituitary gland development
GO:0042448 IDA:RGD P progesterone metabolic process
GO:0042493 IMP:RGD P response to drug
GO:0032355 IEP:RGD P response to estradiol
GO:0043627 IEP:RGD P response to estrogen
GO:0032354 IEP:RGD P response to follicle-stimulating hormone
GO:0060992 IEP:RGD P response to fungicide
GO:0060416 IEP:RGD P response to growth hormone
GO:0014850 IEP:RGD P response to muscle activity
GO:0014070 IEP:RGD P response to organic cyclic compound
GO:0033574 IEP:RGD P response to testosterone
GO:0042428 IEP:RGD P serotonin metabolic process
GO:0021510 IEP:RGD P spinal cord development
GO:0006694 IDA:RGD P steroid biosynthetic process
GO:0021794 IEP:RGD P thalamus development
GO:0001655 IEP:RGD P urogenital system development

KEGG Pathway Links

KEGG Pathway ID Description
ko00140 Steroid hormone biosynthesis
rno00140 Steroid hormone biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5953941 Androgen biosynthesis
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5953937 Metabolism of steroid hormones and vitamin D

Domain Information

InterPro Annotations

Accession Description
IPR016636 3-oxo-5-alpha-steroid 4-dehydrogenase
IPR001104 3-oxo-5-alpha-steroid 4-dehydrogenase, C-terminal

UniProt Annotations

Entry Information

Gene Name
steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)
Protein Entry
S5A1_RAT
UniProt ID
P24008
Species
Rat

Comments

Comment Type Description
Alternative Products Event=Alternative initiation; Named isoforms=2; Name=Long; IsoId=P24008-1; Sequence=Displayed; Name=Short; IsoId=P24008-2; Sequence=VSP_018884;
Biophysicochemical Properties pH dependence: Optimally active at alkaline pHs.;
Catalytic Activity A 3-oxo-5-alpha-steroid + NADP(+) = a 3-oxo- Delta(4)-steroid + NADPH.
Developmental Stage After the establishment of chromosomal sex at fertilization.
Function Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5- alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.
Induction Its expression is regulated by androgens such as testosterone.
Similarity Belongs to the steroid 5-alpha reductase family
Subcellular Location Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane ; Multi-pass membrane protein .
Tissue Specificity Liver and prostate (at a low level).

Identical and Related Proteins

Unique RefSeq proteins for LMP012454 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
77404421 RefSeq NP_058766 255 3-oxo-5-alpha-steroid 4-dehydrogenase 1

Identical Sequences to LMP012454 proteins

Reference Database Accession Length Protein Name
GI:77404421 GenBank AAA71247.1 255 Sequence 2 from patent US 5422262
GI:77404421 GenBank AAI27455.1 255 Steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) [Rattus norvegicus]
GI:77404421 GenBank EDL87610.1 255 steroid 5 alpha-reductase 1 [Rattus norvegicus]
GI:77404421 pat US 255 Sequence 2 from patent US 5679521

Related Sequences to LMP012454 proteins

Reference Database Accession Length Protein Name
GI:77404421 GenBank AAA42102.1 255 steroid 5 alpha-reductase (EC 1.3.99.5) [Rattus norvegicus]
GI:77404421 GenBank AAA71247.1 255 Sequence 2 from patent US 5422262
GI:77404421 GenBank AAI27455.1 255 Steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) [Rattus norvegicus]