Gene/Proteome Database (LMPD)
LMPD ID
LMP012454
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)
Gene Symbol
Synonyms
S5AR 1;
Alternate Names
3-oxo-5-alpha-steroid 4-dehydrogenase 1; SR type 1; steroid 5 alpha-reductase 1; steroid 5-alpha-reductase 1; steroid-5-alpha-reductase 1;
Chromosome
17
Map Location
17p14
EC Number
1.3.1.22
Summary
catalyzes the conversion of testosterone to dihydrotestosterone; required for male sex differentiation [RGD, Feb 2006]
Orthologs
Proteins
3-oxo-5-alpha-steroid 4-dehydrogenase 1 | |
---|---|
Refseq ID | NP_058766 |
Protein GI | 77404421 |
UniProt ID | P24008 |
mRNA ID | NM_017070 |
Length | 255 |
MELDELCLLDMLVYLEGFMAFVSIVGLRSVGSPYGRYSPQWPGIRVPARPAWFIQELPSMAWPLYEYIRPAAARLGNLPNRVLLAMFLIHYVQRTLVFPVLIRGGKPTLLVTFVLAFLFCTFNGYVQSRYLSQFAVYAEDWVTHPCFLTGFALWLVGMVINIHSDHILRNLRKPGETGYKIPRGGLFEYVSAANYFGELVEWCGFALASWSLQGVVFALFTLSTLLTRAKQHHQWYHEKFEDYPKSRKILIPFVL |
Gene Information
Entrez Gene ID
Gene Name
steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0070852 | IDA:RGD | C | cell body fiber |
GO:0005737 | IDA:RGD | C | cytoplasm |
GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0043231 | IDA:RGD | C | intracellular membrane-bounded organelle |
GO:0043209 | IDA:RGD | C | myelin sheath |
GO:0043025 | IDA:RGD | C | neuronal cell body |
GO:0048471 | IDA:RGD | C | perinuclear region of cytoplasm |
GO:0003865 | ISS:UniProtKB | F | 3-oxo-5-alpha-steroid 4-dehydrogenase activity |
GO:0033218 | IDA:RGD | F | amide binding |
GO:0047751 | IEA:UniProtKB-EC | F | cholestenone 5-alpha-reductase activity |
GO:0070402 | IDA:RGD | F | NADPH binding |
GO:0006702 | IDA:RGD | P | androgen biosynthetic process |
GO:0008209 | IDA:RGD | P | androgen metabolic process |
GO:0060348 | IEP:RGD | P | bone development |
GO:0030154 | IEA:UniProtKB-KW | P | cell differentiation |
GO:0071320 | IEP:RGD | P | cellular response to cAMP |
GO:0071549 | IEP:RGD | P | cellular response to dexamethasone stimulus |
GO:0071872 | IEP:RGD | P | cellular response to epinephrine stimulus |
GO:0071392 | IEP:RGD | P | cellular response to estradiol stimulus |
GO:0071363 | IEP:RGD | P | cellular response to growth factor stimulus |
GO:0032869 | IEP:RGD | P | cellular response to insulin stimulus |
GO:0071407 | IEP:RGD | P | cellular response to organic cyclic compound |
GO:0009267 | IEP:RGD | P | cellular response to starvation |
GO:0071394 | IEP:RGD | P | cellular response to testosterone stimulus |
GO:0021987 | IEP:RGD | P | cerebral cortex development |
GO:0042747 | IEP:RGD | P | circadian sleep/wake cycle, REM sleep |
GO:0016101 | IEP:RGD | P | diterpenoid metabolic process |
GO:0030540 | IEP:RGD | P | female genitalia development |
GO:0021766 | IEP:RGD | P | hippocampus development |
GO:0021854 | IEP:RGD | P | hypothalamus development |
GO:0001889 | IEP:RGD | P | liver development |
GO:0030539 | IEP:RGD | P | male genitalia development |
GO:0008584 | IEP:RGD | P | male gonad development |
GO:0046661 | TAS:RGD | P | male sex differentiation |
GO:0021983 | IEP:RGD | P | pituitary gland development |
GO:0042448 | IDA:RGD | P | progesterone metabolic process |
GO:0042493 | IMP:RGD | P | response to drug |
GO:0032355 | IEP:RGD | P | response to estradiol |
GO:0043627 | IEP:RGD | P | response to estrogen |
GO:0032354 | IEP:RGD | P | response to follicle-stimulating hormone |
GO:0060992 | IEP:RGD | P | response to fungicide |
GO:0060416 | IEP:RGD | P | response to growth hormone |
GO:0014850 | IEP:RGD | P | response to muscle activity |
GO:0014070 | IEP:RGD | P | response to organic cyclic compound |
GO:0033574 | IEP:RGD | P | response to testosterone |
GO:0042428 | IEP:RGD | P | serotonin metabolic process |
GO:0021510 | IEP:RGD | P | spinal cord development |
GO:0006694 | IDA:RGD | P | steroid biosynthetic process |
GO:0021794 | IEP:RGD | P | thalamus development |
GO:0001655 | IEP:RGD | P | urogenital system development |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00140 | Steroid hormone biosynthesis |
rno00140 | Steroid hormone biosynthesis |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)
Protein Entry
S5A1_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative initiation; Named isoforms=2; Name=Long; IsoId=P24008-1; Sequence=Displayed; Name=Short; IsoId=P24008-2; Sequence=VSP_018884; |
Biophysicochemical Properties | pH dependence: Optimally active at alkaline pHs.; |
Catalytic Activity | A 3-oxo-5-alpha-steroid + NADP(+) = a 3-oxo- Delta(4)-steroid + NADPH. |
Developmental Stage | After the establishment of chromosomal sex at fertilization. |
Function | Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5- alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology. |
Induction | Its expression is regulated by androgens such as testosterone. |
Similarity | Belongs to the steroid 5-alpha reductase family |
Subcellular Location | Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane ; Multi-pass membrane protein . |
Tissue Specificity | Liver and prostate (at a low level). |
Identical and Related Proteins
Unique RefSeq proteins for LMP012454 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
77404421 | RefSeq | NP_058766 | 255 | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
Identical Sequences to LMP012454 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:77404421 | GenBank | AAA71247.1 | 255 | Sequence 2 from patent US 5422262 |
GI:77404421 | GenBank | AAI27455.1 | 255 | Steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) [Rattus norvegicus] |
GI:77404421 | GenBank | EDL87610.1 | 255 | steroid 5 alpha-reductase 1 [Rattus norvegicus] |
GI:77404421 | pat | US | 255 | Sequence 2 from patent US 5679521 |
Related Sequences to LMP012454 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:77404421 | GenBank | AAA42102.1 | 255 | steroid 5 alpha-reductase (EC 1.3.99.5) [Rattus norvegicus] |
GI:77404421 | GenBank | AAA71247.1 | 255 | Sequence 2 from patent US 5422262 |
GI:77404421 | GenBank | AAI27455.1 | 255 | Steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) [Rattus norvegicus] |