Gene/Proteome Database (LMPD)

LMPD ID
LMP012479
Gene ID
25197
Species
Rattus norvegicus (Rat)
Gene Name
ST6 beta-galactosamide alpha-2,6-sialyltranferase 1
Gene Symbol
St6gal1
Synonyms
Siat1;
Alternate Names
beta-galactoside alpha-2,6-sialyltransferase 1; ST6GalI; ST6Gal I; alpha 2,6-ST 1; beta galactoside alpha 2,6 sialyltransferase 1; Sialyltransferase 1 (beta-galactoside alpha-26-sialytransferase); Sialyltransferase 1 (beta-galactoside alpha-2,6-sialytransferase); CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1;
Chromosome
11
Map Location
11q23
EC Number
2.4.99.1
Summary
may be involved in cell-type specific terminal glycosylation [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for St6gal1

Proteins

beta-galactoside alpha-2,6-sialyltransferase 1 isoform 1
Refseq ID NP_001106815
Protein GI 164519128
UniProt ID P13721
mRNA ID NM_001113344
Length 403
MIHTNLKKKFSLFILVFLLFAVICVWKKGSDYEALTLQAKEFQMPKSQEKVAMGSASQVVFSNSKQDPKEDIPILSYHRVTAKVKPQPSFQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKVGPWQRCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGSKTTIRLMNSQLVTTEKRFLKDSLYTEGILIVWDPSVYHADIPKWYQKPDYNFFETYKSYRRLNPSQPFYILKPQMPWELWDIIQEISADLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNIRC
beta-galactoside alpha-2,6-sialyltransferase 1 isoform 2
Refseq ID NP_671738
Protein GI 164519126
UniProt ID P13721
mRNA ID NM_147205
Length 214
MRYLLFWYGLPHSYSQCVCHWTPASGIFENEPLLSLLLLLLGKLVTTEKRFLKDSLYTEGILIVWDPSVYHADIPKWYQKPDYNFFETYKSYRRLNPSQPFYILKPQMPWELWDIIQEISADLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNIRC

Gene Information

Entrez Gene ID
25197
Gene Name
ST6 beta-galactosamide alpha-2,6-sialyltranferase 1
Gene Symbol
St6gal1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005576 IEA:UniProtKB-KW C extracellular region
GO:0030173 IEA:InterPro C integral component of Golgi membrane
GO:0003835 ISS:UniProtKB F beta-galactoside alpha-2,6-sialyltransferase activity
GO:0006054 ISS:UniProtKB P N-acetylneuraminate metabolic process
GO:0018279 ISS:UniProtKB P protein N-linked glycosylation via asparagine
GO:0097503 ISS:UniProtKB P sialylation

KEGG Pathway Links

KEGG Pathway ID Description
rno01100 Metabolic pathways
ko00510 N-Glycan biosynthesis
rno00510 N-Glycan biosynthesis
M00075 N-glycan biosynthesis, complex type
ko00514 Other types of O-glycan biosynthesis
rno00514 Other types of O-glycan biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5953739 Asparagine N-linked glycosylation
5953738 Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
5953345 Metabolism of proteins
5954395 N-Glycan antennae elongation
5954394 N-glycan antennae elongation in the medial/trans-Golgi
5954369 O-linked glycosylation
5954368 O-linked glycosylation of mucins
5953728 Post-translational protein modification
5954270 Sialic acid metabolism
5953737 Synthesis of substrates in N-glycan biosythesis
5954401 Termination of O-glycan biosynthesis
5954050 Transport to the Golgi and subsequent modification

Domain Information

InterPro Annotations

Accession Description
IPR001675 Glycosyl transferase, family 29
IPR012163 Sialyltransferase

UniProt Annotations

Entry Information

Gene Name
ST6 beta-galactosamide alpha-2,6-sialyltranferase 1
Protein Entry
SIAT1_RAT
UniProt ID
P13721
Species
Rat

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=3; Name=RLA; IsoId=P13721-1; Sequence=Displayed; Name=RKA; IsoId=P13721-2; Sequence=VSP_001782; Name=RKB; IsoId=P13721-3; Sequence=VSP_001783;
Catalytic Activity CMP-N-acetylneuraminate + beta-D-galactosyl- 1,4-N-acetyl-beta-D-glucosamine = CMP + alpha-N-acetylneuraminyl- 2,6-beta-D-galactosyl-1,4-N-acetyl-beta-D-glucosamine
Function Transfers sialic acid from CMP-sialic acid to galactose- containing acceptor substrates
Pathway Protein modification; protein glycosylation.
Ptm The soluble form derives from the membrane form by proteolytic processing.
Similarity Belongs to the glycosyltransferase 29 family
Subcellular Location Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Secreted. Note=Membrane- bound form in trans cisternae of Golgi. Secreted into the body fluid.
Tissue Specificity Strongly expressed in liver, spleen, lung, kidney and submaxillary gland and weakly in heart and brain.

Identical and Related Proteins

Unique RefSeq proteins for LMP012479 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
164519128 RefSeq NP_001106815 403 beta-galactoside alpha-2,6-sialyltransferase 1 isoform 1
164519126 RefSeq NP_671738 214 beta-galactoside alpha-2,6-sialyltransferase 1 isoform 2

Identical Sequences to LMP012479 proteins

Reference Database Accession Length Protein Name
GI:164519126 GenBank AAB22858.1 214 beta-Galactoside alpha 2,6-sialyltransferase isoprotein RKA, SiaT-1=glycosyltransferase [Rattus sp.]
GI:164519128 GenBank EDL78084.1 403 rCG36561, isoform CRA_a [Rattus norvegicus]
GI:164519128 GenBank EDL78085.1 403 rCG36561, isoform CRA_a [Rattus norvegicus]
GI:164519128 RefSeq XP_006248563.1 403 PREDICTED: beta-galactoside alpha-2,6-sialyltransferase 1 isoform X1 [Rattus norvegicus]

Related Sequences to LMP012479 proteins

Reference Database Accession Length Protein Name
GI:164519126 GenBank AAB22858.1 214 beta-Galactoside alpha 2,6-sialyltransferase isoprotein RKA, SiaT-1=glycosyltransferase [Rattus sp.]
GI:164519126 GenBank AAB22859.1 184 beta-Galactoside alpha 2,6-sialyltransferase isoprotein RKB, SiaT-1=glycosyltransferase [Rattus sp.]
GI:164519126 GenBank AAB07233.1 214 beta-galactoside-alpha 2,6-sialyltransferase [Rattus norvegicus]
GI:164519128 GenBank EDL78084.1 403 rCG36561, isoform CRA_a [Rattus norvegicus]
GI:164519128 GenBank EDL78085.1 403 rCG36561, isoform CRA_a [Rattus norvegicus]
GI:164519128 RefSeq XP_006248563.1 403 PREDICTED: beta-galactoside alpha-2,6-sialyltransferase 1 isoform X1 [Rattus norvegicus]