Gene/Proteome Database (LMPD)
LMPD ID
LMP012517
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Gene Symbol
Synonyms
Prkaac; Prkga1;
Alternate Names
5'-AMP-activated protein kinase subunit gamma-1; AMPKg; AMPK gamma1; AMPK gamma-1 chain; AMPK subunit gamma-1; Protein kinase AMP-activated gamma; AMP-activated protein kinase, noncatalytic gamma-1 subunit;
Chromosome
7
Map Location
chromosome:7
Summary
non-catalytic component of the heterotrimeric AMP-activated protein kinase; may phosphorylate and inactivate enzymes involved in lipid metabolism; may play a role in response to metabolic stress [RGD, Feb 2006]
Orthologs
Proteins
| 5'-AMP-activated protein kinase subunit gamma-1 | |
|---|---|
| Refseq ID | NP_037142 |
| Protein GI | 6981392 |
| UniProt ID | P80385 |
| mRNA ID | NM_013010 |
| Length | 330 |
| MESVAAESAPAPENEHSQETPESNSSVYTTFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLEAIINRLVEAEVHRLVVVDEHDVVKGIVSLSDILQALVLTGGEKKP | |
Gene Information
Entrez Gene ID
Gene Name
protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0031588 | IDA:UniProtKB | C | AMP-activated protein kinase complex |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0005654 | TAS:Reactome | C | nucleoplasm |
| GO:0043234 | IDA:RGD | C | protein complex |
| GO:0043531 | IDA:UniProtKB | F | ADP binding |
| GO:0016208 | IDA:UniProtKB | F | AMP binding |
| GO:0005524 | IDA:UniProtKB | F | ATP binding |
| GO:0004672 | IEA:Ensembl | F | protein kinase activity |
| GO:0019901 | IPI:RGD | F | protein kinase binding |
| GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
| GO:0010628 | IEA:Ensembl | P | positive regulation of gene expression |
| GO:0051291 | IDA:RGD | P | protein heterooligomerization |
| GO:0050790 | IDA:RGD | P | regulation of catalytic activity |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko04152 | AMPK signaling pathway |
| rno04152 | AMPK signaling pathway |
| ko04920 | Adipocytokine signaling pathway |
| rno04920 | Adipocytokine signaling pathway |
| ko04710 | Circadian rhythm |
| rno04710 | Circadian rhythm |
| rno04068 | FoxO signaling pathway |
| ko05410 | Hypertrophic cardiomyopathy (HCM) |
| rno05410 | Hypertrophic cardiomyopathy (HCM) |
| ko04910 | Insulin signaling pathway |
| rno04910 | Insulin signaling pathway |
| ko04932 | Non-alcoholic fatty liver disease (NAFLD) |
| rno04932 | Non-alcoholic fatty liver disease (NAFLD) |
| ko04921 | Oxytocin signaling pathway |
| rno04921 | Oxytocin signaling pathway |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5954481 | Activation of PPARGC1A (PGC-1alpha) by phosphorylation |
| 5954019 | Energy dependent regulation of mTOR by LKB1-AMPK |
| 5953430 | IGF1R signaling cascade |
| 5953428 | IRS-mediated signalling |
| 5953425 | IRS-related events |
| 5953429 | IRS-related events triggered by IGF1R |
| 5953422 | Insulin receptor signalling cascade |
| 5953916 | Membrane Trafficking |
| 5953600 | Mitochondrial biogenesis |
| 5953601 | Organelle biogenesis and maintenance |
| 5953432 | PI3K Cascade |
| 5953733 | PKB-mediated events |
| 5954018 | Regulation of AMPK activity via LKB1 |
| 5954161 | Regulation of Rheb GTPase activity by AMPK |
| 5953381 | Signal Transduction |
| 5953423 | Signaling by Insulin receptor |
| 5953431 | Signaling by Type 1 Insulin-like Growth Factor 1 Receptor (IGF1R) |
| 5954455 | Translocation of GLUT4 to the plasma membrane |
| 5953766 | mTOR signalling |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR000644 | CBS domain |
UniProt Annotations
Entry Information
Gene Name
protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Protein Entry
AAKG1_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Domain | The AMPK pseudosubstrate motif resembles the sequence around sites phosphorylated on target proteins of AMPK, except the presence of a non-phosphorylatable residue in place of Ser. In the absence of AMP this pseudosubstrate sequence may bind to the active site groove on the alpha subunit (PRKAA1 or PRKAA2), preventing phosphorylation by the upstream activating kinase STK11/LKB1 (By similarity) |
| Domain | The CBS domains mediate binding to AMP, ADP and ATP. 2 sites bind either AMP or ATP, whereas a third site contains a tightly bound AMP that does not exchange. Under physiological conditions AMPK mainly exists in its inactive form in complex with ATP, which is much more abundant than AMP |
| Function | AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Gamma non-catalytic subunit mediates binding to AMP, ADP and ATP, leading to activate or inhibit AMPK: AMP-binding results in allosteric activation of alpha catalytic subunit (PRKAA1 or PRKAA2) both by inducing phosphorylation and preventing dephosphorylation of catalytic subunits. ADP also stimulates phosphorylation, without stimulating already phosphorylated catalytic subunit. ATP promotes dephosphorylation of catalytic subunit, rendering the AMPK enzyme inactive |
| Ptm | Phosphorylated by ULK1 and ULK2; leading to negatively regulate AMPK activity and suggesting the existence of a regulatory feedback loop between ULK1, ULK2 and AMPK. There is some ambiguity for a phosphosite: Ser-260/Thr-262 |
| Similarity | Belongs to the 5'-AMP-activated protein kinase gamma subunit family |
| Similarity | Contains 4 CBS domains. {ECO:0000255|PROSITE- ProRule:PRU00703}. |
| Subunit | AMPK is a heterotrimer of an alpha catalytic subunit (PRKAA1 or PRKAA2), a beta (PRKAB1 or PRKAB2) and a gamma non- catalytic subunits (PRKAG1, PRKAG2 or PRKAG3). Interacts with FNIP1 and FNIP2. {ECO:0000269|PubMed:17851531, ECO:0000269|PubMed:21399626}. |
| Tissue Specificity | Highly expressed in heart and brain, also found in kidney, white adipose tissue, lung and spleen. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012517 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6981392 | RefSeq | NP_037142 | 330 | 5'-AMP-activated protein kinase subunit gamma-1 |
Identical Sequences to LMP012517 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6981392 | PDB | 4CFH | 330 | Chain E, Structure Of An Active Form Of Mammalian Ampk |
| GI:6981392 | PDB | 4QFG | 330 | Chain C, Structure Of Ampk In Complex With Staurosporine Inhibitor And In The Absence Of A Synthetic Activator |
| GI:6981392 | PDB | 4QFR | 330 | Chain C, Structure Of Ampk In Complex With Cl-a769662 Activator And Staurosporine Inhibitor |
| GI:6981392 | PDB | 4QFS | 330 | Chain C, Structure Of Ampk In Complex With Br2-a769662core Activator And Staurosporine Inhibitor |
Related Sequences to LMP012517 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6981392 | PDB | 2Y8L | 330 | Chain E, Structure Of The Regulatory Fragment Of Mammalian Ampk In Complex With Two Adp |
| GI:6981392 | PDB | 2Y8Q | 330 | Chain E, Structure Of The Regulatory Fragment Of Mammalian Ampk In Complex With One Adp |
| GI:6981392 | PDB | 2YA3 | 330 | Chain E, Structure Of The Regulatory Fragment Of Mammalian Ampk In Complex With Coumarin Adp |