Gene/Proteome Database (LMPD)
LMPD ID
LMP012520
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
prostaglandin D2 synthase (brain)
Gene Symbol
Synonyms
PH2DISO;
Alternate Names
prostaglandin-H2 D-isomerase; PGDS; PGDS2; PGD2 synthase; Prostaglandin D synthase; prostaglandin-D2 synthase; glutathione-independent PGD synthase; glutathione-independent PGD synthetase; lipocalin-type prostaglandin-D synthase;
Chromosome
3
Map Location
3p13
EC Number
5.3.99.2
Summary
catalyzes conversion of prostaglandin H2 to prostaglandin D2, a major prostaglandin that mediates sleep, body temperature, hormone release, and odor responses [RGD, Feb 2006]
Orthologs
Proteins
| prostaglandin-H2 D-isomerase precursor | |
|---|---|
| Refseq ID | NP_037147 |
| Protein GI | 6981430 |
| UniProt ID | P22057 |
| mRNA ID | NM_013015 |
| Length | 189 |
| MAALPMLWTGLVLLGLLGFPQTPAQGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKELLFMCQTVVAPSTEGGLNLTSTFLRKNQCETKVMVLQPAGVPGQYTYNSPHWGSFHSLSVVETDYDEYAFLFSKGTKGPGQDFRMATLYSRAQLLKEELKEKFITFSKDQGLTEEDIVFLPQPDKCIQE | |
| sig_peptide: 1..24 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P22057.2) calculated_mol_wt: 2511 peptide sequence: MAALPMLWTGLVLLGLLGFPQTPA mat_peptide: 25..189 product: Prostaglandin-H2 D-isomerase experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P22057.2) calculated_mol_wt: 18808 peptide sequence: QGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKELLFMCQTVVAPSTEGGLNLTSTFLRKNQCETKVMVLQPAGVPGQYTYNSPHWGSFHSLSVVETDYDEYAFLFSKGTKGPGQDFRMATLYSRAQLLKEELKEKFITFSKDQGLTEEDIVFLPQPDKCIQE | |
Gene Information
Entrez Gene ID
Gene Name
prostaglandin D2 synthase (brain)
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IDA:UniProtKB | C | Golgi apparatus |
| GO:0005576 | IDA:UniProtKB | C | extracellular region |
| GO:0005615 | IDA:RGD | C | extracellular space |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0016020 | IEA:UniProtKB-KW | C | membrane |
| GO:0005635 | NAS:UniProtKB | C | nuclear envelope |
| GO:0005791 | ISS:UniProtKB | C | rough endoplasmic reticulum |
| GO:0005504 | IEA:Ensembl | F | fatty acid binding |
| GO:0004667 | IDA:UniProtKB | F | prostaglandin-D synthase activity |
| GO:0005501 | IDA:UniProtKB | F | retinoid binding |
| GO:0005215 | IDA:UniProtKB | F | transporter activity |
| GO:0001516 | IDA:UniProtKB | P | prostaglandin biosynthetic process |
| GO:0045187 | ISS:UniProtKB | P | regulation of circadian sleep/wake cycle, sleep |
| GO:0051384 | IEP:RGD | P | response to glucocorticoid |
| GO:0006810 | IDA:UniProtKB | P | transport |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00590 | Arachidonic acid metabolism |
| rno00590 | Arachidonic acid metabolism |
| rno01100 | Metabolic pathways |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | (5Z,13E,15S)-9-alpha,11-alpha-epidioxy-15- hydroxyprosta-5,13-dienoate = (5Z,13E,15S)-9-alpha,15-dihydroxy- 11-oxoprosta-5,13-dienoate. |
| Developmental Stage | In the brain it is localized in many neurons at 1-2 weeks after birth, whereas in mature animals it is localized to tissues of the blood-brain barrier |
| Domain | Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior |
| Function | Catalyzes the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation. Involved in a variety of CNS functions, such as sedation, NREM sleep and PGE2-induced allodynia, and may have an anti-apoptotic role in oligodendrocytes. Binds small non-substrate lipophilic molecules, including biliverdin, bilirubin, retinal, retinoic acid and thyroid hormone, and may act as a scavenger for harmful hydrophopic molecules and as a secretory retinoid and thyroid hormone transporter. Possibly involved in development and maintenance of the blood-brain, blood-retina, blood-aqueous humor and blood-testis barrier. It is likely to play important roles in both maturation and maintenance of the central nervous system and male reproductive system. {ECO:0000269|PubMed:10387044, ECO:0000269|PubMed:10650953, ECO:0000269|PubMed:11058225, ECO:0000269|PubMed:9188476}. |
| Induction | By IL-1 beta and thyroid hormone. Probably induced by dexamethasone, dihydrotestosterone, progesterone, retinoic acid and retinal. Repressed by the Notch-Hes signaling pathway. {ECO:0000269|PubMed:10650953, ECO:0000269|PubMed:12488457, ECO:0000269|PubMed:9582446, ECO:0000269|PubMed:9746734}. |
| Mass Spectrometry | Mass=18808; Method=MALDI; Range=25-189; Evidence= ; |
| Similarity | Belongs to the calycin superfamily. Lipocalin family |
| Subcellular Location | Rough endoplasmic reticulum. Nucleus membrane. Golgi apparatus. Cytoplasm, perinuclear region. Secreted. Note=Detected on rough endoplasmic reticulum of arachnoid and menigioma cells. Localized to the nuclear envelope, Golgi apparatus, secretory vesicles and spherical cytoplasmic structures in arachnoid trabecular cells, and to circular cytoplasmic structures in meningeal macrophages and perivascular microglial cells. In oligodendrocytes, localized to the rough endoplasmic reticulum and nuclear envelope. In retinal pigment epithelial cells, localized to distinct cytoplasmic domains including the perinuclear region. Also secreted. |
| Subunit | Monomer |
| Tissue Specificity | Abundant in the brain and CNS, where it is expressed in tissues of the blood-brain barrier and secreted into the cerebro-spinal fluid. In the eye, it is expressed in the pigmented epithelium of the retina and the nonpigmented epithelium of the iris and ciliary body, and accumulates within the interphotoreceptor matrix, photoreceptors, and aqueous and vitreous humors. In the male reproductive system, it is expressed in the testis and epididymis, and is secreted into the seminal fluid. It has also been detected in the cochlea. {ECO:0000269|PubMed:10650953, ECO:0000269|PubMed:11058225, ECO:0000269|PubMed:11565799, ECO:0000269|PubMed:2642896, ECO:0000269|PubMed:8415655, ECO:0000269|PubMed:8599604, ECO:0000269|PubMed:8815894, ECO:0000269|PubMed:9430563, ECO:0000269|PubMed:9746734}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012520 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6981430 | RefSeq | NP_037147 | 189 | prostaglandin-H2 D-isomerase precursor |
Identical Sequences to LMP012520 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6981430 | GenBank | AAA41840.1 | 189 | prostaglandin H2 D-isomerase [Rattus norvegicus] |
| GI:6981430 | GenBank | EDL93575.1 | 189 | prostaglandin D2 synthase, isoform CRA_a [Rattus norvegicus] |
| GI:6981430 | GenBank | EDL93576.1 | 189 | prostaglandin D2 synthase, isoform CRA_a [Rattus norvegicus] |
| GI:6981430 | SwissProt | P22057.2 | 189 | RecName: Full=Prostaglandin-H2 D-isomerase; AltName: Full=Glutathione-independent PGD synthase; AltName: Full=Lipocalin-type prostaglandin-D synthase; AltName: Full=Prostaglandin-D2 synthase; Short=PGD2 synthase; Short=PGDS; Short=PGDS2; Flags: Precursor [Rattus norvegicus] |
Related Sequences to LMP012520 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6981430 | GenBank | AAA41839.1 | 189 | prostaglandin D synthetase [Rattus norvegicus] |
| GI:6981430 | GenBank | EDL93575.1 | 189 | prostaglandin D2 synthase, isoform CRA_a [Rattus norvegicus] |
| GI:6981430 | GenBank | EDL93576.1 | 189 | prostaglandin D2 synthase, isoform CRA_a [Rattus norvegicus] |