Gene/Proteome Database (LMPD)
LMPD ID
LMP012522
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
Rab geranylgeranyltransferase, beta subunit
Gene Symbol
Alternate Names
geranylgeranyl transferase type-2 subunit beta; GGTase-II-beta; rab GGTase beta; rab GG transferase beta; rab geranylgeranyltransferase subunit beta; rab geranyl-geranyltransferase subunit beta; geranylgeranyl transferase type II subunit beta; Rab geranylgeranyl transferase componenet, subunit beta; type II protein geranyl-geranyltransferase subunit beta;
Chromosome
2
Map Location
2q45
EC Number
2.5.1.60
Summary
subunit of Rab geranylgeranyl transferase, which catalyses the transfer of geranylgeranyl groups to Rab protein cysteine residues [RGD, Feb 2006]
Orthologs
Proteins
| geranylgeranyl transferase type-2 subunit beta | |
|---|---|
| Refseq ID | NP_619715 |
| Protein GI | 20177500 |
| UniProt ID | Q08603 |
| mRNA ID | NM_138708 |
| Length | 331 |
| MGTQQKDVTIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS | |
Gene Information
Entrez Gene ID
Gene Name
Rab geranylgeranyltransferase, beta subunit
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005968 | IDA:UniProtKB | C | Rab-protein geranylgeranyltransferase complex |
| GO:0017137 | IDA:UniProtKB | F | Rab GTPase binding |
| GO:0004663 | IDA:UniProtKB | F | Rab geranylgeranyltransferase activity |
| GO:0008270 | IDA:UniProtKB | F | zinc ion binding |
| GO:0018344 | IDA:UniProtKB | P | protein geranylgeranylation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
Rab geranylgeranyltransferase, beta subunit
Protein Entry
PGTB2_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Geranylgeranyl diphosphate + protein-cysteine = S-geranylgeranyl-protein + diphosphate. {ECO:0000269|PubMed:18399557, ECO:0000269|PubMed:18756270, ECO:0000269|PubMed:19894725, ECO:0000269|PubMed:22480322, ECO:0000269|PubMed:22963166, ECO:0000269|PubMed:8505342}. |
| Cofactor | Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000269|PubMed:10745007, ECO:0000269|PubMed:12620235, ECO:0000269|PubMed:18399557, ECO:0000269|PubMed:18756270, ECO:0000269|PubMed:19894725, ECO:0000269|PubMed:22480322, ECO:0000269|PubMed:22963166}; Note=Binds 1 zinc ion per subunit. {ECO:0000269|PubMed:10745007, ECO:0000269|PubMed:12620235, ECO:0000269|PubMed:18399557, ECO:0000269|PubMed:18756270, ECO:0000269|PubMed:19894725, ECO:0000269|PubMed:22480322, ECO:0000269|PubMed:22963166}; |
| Enzyme Regulation | The enzymatic reaction requires the aid of a Rab escort protein (also called component A), such as CHM. |
| Function | Catalyzes the transfer of a geranylgeranyl moiety from geranylgeranyl diphosphate to both cysteines of Rab proteins with the C-terminal sequence -XXCC, -XCXC and -CCXX, such as RAB1A, RAB3A, RAB5A and RAB7A. {ECO:0000269|PubMed:18399557, ECO:0000269|PubMed:18756270, ECO:0000269|PubMed:19894725, ECO:0000269|PubMed:22480322, ECO:0000269|PubMed:22963166, ECO:0000269|PubMed:8505342}. |
| Similarity | Belongs to the protein prenyltransferase subunit beta family |
| Similarity | Contains 6 PFTB repeats |
| Subunit | Heterotrimer composed of RABGGTA, RABGGTB and CHM; within this trimer, RABGGTA and RABGGTB form the catalytic component B, while CHM (component A) mediates peptide substrate binding. The Rab GGTase dimer (RGGT) interacts with CHM (component A) prior to Rab protein binding; the association is stabilized by geranylgeranyl pyrophosphate (GGpp). The CHM:RGGT:Rab complex is destabilized by GGpp. Interaction of RABGGTB with prenylated PTP4A2 precludes its association with RABGGTA and inhibits enzyme activity. {ECO:0000269|PubMed:10745007, ECO:0000269|PubMed:11675392, ECO:0000269|PubMed:12620235, ECO:0000269|PubMed:18399557, ECO:0000269|PubMed:18756270, ECO:0000269|PubMed:19894725, ECO:0000269|PubMed:22480322, ECO:0000269|PubMed:22963166, ECO:0000269|PubMed:8505342}. |
| Tissue Specificity | Most abundant in the heart, brain, spleen and liver. Less in the lung, muscle, kidney and testis; in these tissues, more abundant than the subunit alpha. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012522 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 20177500 | RefSeq | NP_619715 | 331 | geranylgeranyl transferase type-2 subunit beta |
Identical Sequences to LMP012522 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:20177500 | PDB | 3HXC | 331 | Chain B, Engineered Rabggtase In Complex With A Peptidomimetic Inhibitor (compound 8) |
| GI:20177500 | PDB | 3HXD | 331 | Chain B, Engineered Rabggtase In Complex With A Peptidomimetic Inhibitor (Compound 9) |
| GI:20177500 | PDB | 3HXE | 331 | Chain B, Engineered Rabggtase In Complex With A Peptidomimetic Inhibitor (compound 37) |
| GI:20177500 | PDB | 3HXF | 331 | Chain B, Engineered Rabggtase In Complex With A Peptidomimetic Inhibitor (compound 32) |
Related Sequences to LMP012522 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:20177500 | PDB | 3HXC | 331 | Chain B, Engineered Rabggtase In Complex With A Peptidomimetic Inhibitor (compound 8) |
| GI:20177500 | PDB | 3HXD | 331 | Chain B, Engineered Rabggtase In Complex With A Peptidomimetic Inhibitor (Compound 9) |
| GI:20177500 | PDB | 3HXE | 331 | Chain B, Engineered Rabggtase In Complex With A Peptidomimetic Inhibitor (compound 37) |