Gene/Proteome Database (LMPD)

LMPD ID
LMP012523
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
sterol carrier protein 2
Gene Symbol
Synonyms
SCPx; NSLIPTR;
Alternate Names
non-specific lipid-transfer protein; SCP-2; SCP-X; NSL-TP; SCP-chi; sterol carrier protein X; Sterol carrier protein 2, liver; propanoyl-CoA C-acyltransferase;
Chromosome
5
Map Location
5q35
EC Number
2.3.1.176
Summary
may play a role in intracellular transport of cholesterol [RGD, Feb 2006]
Orthologs

Proteins

non-specific lipid-transfer protein
Refseq ID NP_612517
Protein GI 50356003
UniProt ID P11915
mRNA ID NM_138508
Length 547
MPSVALNSPRLPRVFVVGVGMTKFMKPGGENSRDYPDLAKEAGQKALADRQIPYSAVEQACVGYVYGESTCGQRAIYHSLGLTGIPIINVNNNCSTGSTALFMAQQLVQGGLANCVLALGFEKMEKGSLGTKYSDRSNPLEKHIDVLINKYGMSACPFAPQLFGSAGKEHMETYGTKVEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEIMKSRPVFDFLTVLQCCPTSDGAAAAIVSSEEFVQKHGLQSKAVEIVAQEMVTDMPTTFEEKSVIKMVGYDMSKEAARKCYEKSGLGPSDVDVIELHDCFSTNELLTYEALGLCPEGQGGALVDRGDNTYGGKWVINPSGGLISKGHPLGATGLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGLGGAAVVTLYRMGFPEAASSFRTHQISAAPTSSAGDGFKANLIFKEIEKKLEEEGEEFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPDSDKKADCTITMADSDLLALMTGKMNPQSAFFQGKLKIAGNMGLAMKLQSLQLQPDKAKL

Gene Information

Entrez Gene ID
Gene Name
sterol carrier protein 2
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005739 IEA:UniProtKB-KW C mitochondrion
GO:0005777 IDA:HGNC C peroxisome
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0033814 IEA:UniProtKB-EC F propanoyl-CoA C-acyltransferase activity
GO:0006869 IEA:UniProtKB-KW P lipid transport
GO:0010893 IDA:UniProtKB P positive regulation of steroid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
rno01100 Metabolic pathways
ko03320 PPAR signaling pathway
rno03320 PPAR signaling pathway
ko04146 Peroxisome
rno04146 Peroxisome
ko00120 Primary bile acid biosynthesis
rno00120 Primary bile acid biosynthesis

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-6061 bile acid biosynthesis, neutral pathway

Domain Information

InterPro Annotations

Accession Description
IPR003033 SCP2 sterol-binding domain
IPR020617 Thiolase, C-terminal
IPR020616 Thiolase, N-terminal
IPR020615 Thiolase, acyl-enzyme intermediate active site
IPR020613 Thiolase, conserved site
IPR016039 Thiolase-like
IPR016038 Thiolase-like, subgroup

UniProt Annotations

Entry Information

Gene Name
sterol carrier protein 2
Protein Entry
NLTP_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Alternative Products Event=Alternative initiation; Named isoforms=2; Name=SCPx; IsoId=P11915-1; Sequence=Displayed; Name=SCP2; IsoId=P11915-2; Sequence=VSP_018897; Note=Mitochondrial precursor. Contains a mitochondrial transit peptide at positions 405-424 (Potential). ;
Catalytic Activity 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta- cholanoyl-CoA + propanoyl-CoA = CoA + 3-alpha,7-alpha,12-alpha- trihydroxy-24-oxo-5-beta-cholestanoyl-CoA.
Function Mediates in vitro the transfer of all common phospholipids, cholesterol and gangliosides between membranes. May play a role in regulating steroidogenesis.
Sequence Caution Sequence=AAA40623.1; Type=Erroneous initiation; Evidence= ; Sequence=CAA43060.1; Type=Erroneous initiation; Evidence= ;
Similarity Contains 1 SCP2 domain
Similarity In the N-terminal section; belongs to the thiolase family
Subcellular Location Cytoplasm. Mitochondrion. Note=Cytoplasmic in the liver and also associated with mitochondria especially in steroidogenic tissues.
Subcellular Location Isoform SCP2: Mitochondrion .
Subcellular Location Isoform SCPx: Peroxisome. Note=Interaction with PEX5 is essential for peroxisomal import
Subunit Interacts with PEX5
Tissue Specificity Liver > intestine > brain > lung, colon, stomach, spleen, kidney, heart and ovary.

Identical and Related Proteins

Unique RefSeq proteins for LMP012523 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
50356003 RefSeq NP_612517 547 non-specific lipid-transfer protein

Identical Sequences to LMP012523 proteins

Reference Database Accession Length Protein Name
GI:50356003 GenBank AAA42122.1 547 sterol carrier protein-x [Rattus norvegicus]

Related Sequences to LMP012523 proteins

Reference Database Accession Length Protein Name
GI:50356003 EMBL CAA43061.1 546 unnamed protein product, partial [Rattus norvegicus]
GI:50356003 GenBank AAA42122.1 547 sterol carrier protein-x [Rattus norvegicus]
GI:50356003 SwissProt P11915.3 547 RecName: Full=Non-specific lipid-transfer protein; Short=NSL-TP; AltName: Full=Propanoyl-CoA C-acyltransferase; AltName: Full=SCP-chi; AltName: Full=SCPX; AltName: Full=Sterol carrier protein 2; Short=SCP-2; AltName: Full=Sterol carrier protein X; Short=SCP-X [Rattus norvegicus]