Gene/Proteome Database (LMPD)
LMPD ID
LMP012523
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
sterol carrier protein 2
Gene Symbol
Synonyms
SCPx; NSLIPTR;
Alternate Names
non-specific lipid-transfer protein; SCP-2; SCP-X; NSL-TP; SCP-chi; sterol carrier protein X; Sterol carrier protein 2, liver; propanoyl-CoA C-acyltransferase;
Chromosome
5
Map Location
5q35
EC Number
2.3.1.176
Summary
may play a role in intracellular transport of cholesterol [RGD, Feb 2006]
Orthologs
Proteins
non-specific lipid-transfer protein | |
---|---|
Refseq ID | NP_612517 |
Protein GI | 50356003 |
UniProt ID | P11915 |
mRNA ID | NM_138508 |
Length | 547 |
MPSVALNSPRLPRVFVVGVGMTKFMKPGGENSRDYPDLAKEAGQKALADRQIPYSAVEQACVGYVYGESTCGQRAIYHSLGLTGIPIINVNNNCSTGSTALFMAQQLVQGGLANCVLALGFEKMEKGSLGTKYSDRSNPLEKHIDVLINKYGMSACPFAPQLFGSAGKEHMETYGTKVEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEIMKSRPVFDFLTVLQCCPTSDGAAAAIVSSEEFVQKHGLQSKAVEIVAQEMVTDMPTTFEEKSVIKMVGYDMSKEAARKCYEKSGLGPSDVDVIELHDCFSTNELLTYEALGLCPEGQGGALVDRGDNTYGGKWVINPSGGLISKGHPLGATGLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGLGGAAVVTLYRMGFPEAASSFRTHQISAAPTSSAGDGFKANLIFKEIEKKLEEEGEEFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPDSDKKADCTITMADSDLLALMTGKMNPQSAFFQGKLKIAGNMGLAMKLQSLQLQPDKAKL |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005739 | IEA:UniProtKB-KW | C | mitochondrion |
GO:0005777 | IDA:HGNC | C | peroxisome |
GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
GO:0033814 | IEA:UniProtKB-EC | F | propanoyl-CoA C-acyltransferase activity |
GO:0006869 | IEA:UniProtKB-KW | P | lipid transport |
GO:0010893 | IDA:UniProtKB | P | positive regulation of steroid biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
rno01100 | Metabolic pathways |
ko04146 | Peroxisome |
rno04146 | Peroxisome |
ko03320 | PPAR signaling pathway |
rno03320 | PPAR signaling pathway |
ko00120 | Primary bile acid biosynthesis |
rno00120 | Primary bile acid biosynthesis |
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
PWY-6061 | bile acid biosynthesis, neutral pathway |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative initiation; Named isoforms=2; Name=SCPx; IsoId=P11915-1; Sequence=Displayed; Name=SCP2; IsoId=P11915-2; Sequence=VSP_018897; Note=Mitochondrial precursor. Contains a mitochondrial transit peptide at positions 405-424 (Potential). ; |
Catalytic Activity | 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta- cholanoyl-CoA + propanoyl-CoA = CoA + 3-alpha,7-alpha,12-alpha- trihydroxy-24-oxo-5-beta-cholestanoyl-CoA. |
Function | Mediates in vitro the transfer of all common phospholipids, cholesterol and gangliosides between membranes. May play a role in regulating steroidogenesis. |
Sequence Caution | Sequence=AAA40623.1; Type=Erroneous initiation; Evidence= ; Sequence=CAA43060.1; Type=Erroneous initiation; Evidence= ; |
Similarity | Contains 1 SCP2 domain |
Similarity | In the N-terminal section; belongs to the thiolase family |
Subcellular Location | Cytoplasm. Mitochondrion. Note=Cytoplasmic in the liver and also associated with mitochondria especially in steroidogenic tissues. |
Subcellular Location | Isoform SCP2: Mitochondrion . |
Subcellular Location | Isoform SCPx: Peroxisome. Note=Interaction with PEX5 is essential for peroxisomal import |
Subunit | Interacts with PEX5 |
Tissue Specificity | Liver > intestine > brain > lung, colon, stomach, spleen, kidney, heart and ovary. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012523 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
50356003 | RefSeq | NP_612517 | 547 | non-specific lipid-transfer protein |
Identical Sequences to LMP012523 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:50356003 | GenBank | AAA42122.1 | 547 | sterol carrier protein-x [Rattus norvegicus] |
Related Sequences to LMP012523 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:50356003 | EMBL | CAA43061.1 | 546 | unnamed protein product, partial [Rattus norvegicus] |
GI:50356003 | GenBank | AAA42122.1 | 547 | sterol carrier protein-x [Rattus norvegicus] |
GI:50356003 | SwissProt | P11915.3 | 547 | RecName: Full=Non-specific lipid-transfer protein; Short=NSL-TP; AltName: Full=Propanoyl-CoA C-acyltransferase; AltName: Full=SCP-chi; AltName: Full=SCPX; AltName: Full=Sterol carrier protein 2; Short=SCP-2; AltName: Full=Sterol carrier protein X; Short=SCP-X [Rattus norvegicus] |