Gene/Proteome Database (LMPD)

LMPD ID
LMP012528
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
tocopherol (alpha) transfer protein
Gene Symbol
Synonyms
TTP;
Alternate Names
alpha-tocopherol transfer protein; alpha-TTP; Tocopherol transfer protein alpha;
Chromosome
5
Map Location
5q21
Summary
binds the vitamin tocopherol and enhances its transfer between separate membranes [RGD, Feb 2006]
Orthologs

Proteins

alpha-tocopherol transfer protein
Refseq ID NP_037180
Protein GI 6981682
UniProt ID P41034
mRNA ID NM_013048
Length 278
MAEMRPGPVVGKQLNEQPDHSPLVQPGLAELRRRAQEEGVPETPQPLTDAFLLRFLRARDFDLDLAWRLMKNYYKWRAECPELSADLHPRSILGLLKAGYHGVLRSRDPTGSRVLIYRISYWDPKVFTAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGWQISHAFQITPSVAKKIAAVVTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKGRIHLHGNNYKSSLLQHFPDILPLEYGGNESSMEDICQEWTNFIMKSEDYLSSISETIQ

Gene Information

Entrez Gene ID
Gene Name
tocopherol (alpha) transfer protein
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IDA:RGD C cytosol
GO:0005770 IDA:RGD C late endosome
GO:0043325 ISS:UniProtKB F phosphatidylinositol-3,4-bisphosphate binding
GO:0005546 ISS:UniProtKB F phosphatidylinositol-4,5-bisphosphate binding
GO:0005215 IEA:InterPro F transporter activity
GO:0008431 IDA:RGD F vitamin E binding
GO:0019842 IDA:RGD F vitamin binding
GO:0032502 IEP:RGD P developmental process
GO:0001892 IEA:Ensembl P embryonic placenta development
GO:0046909 ISS:UniProtKB P intermembrane transport
GO:0051452 IDA:RGD P intracellular pH reduction
GO:0060548 IDA:RGD P negative regulation of cell death
GO:0090212 IEA:Ensembl P negative regulation of establishment of blood-brain barrier
GO:0007584 IEP:RGD P response to nutrient
GO:0009268 IDA:RGD P response to pH
GO:0009636 IEA:Ensembl P response to toxic substance
GO:0042360 IDA:RGD P vitamin E metabolic process
GO:0051180 ISS:UniProtKB P vitamin transport

Domain Information

InterPro Annotations

Accession Description
IPR001251 CRAL-TRIO domain
IPR011074 CRAL/TRIO, N-terminal domain
IPR001071 Cellular retinaldehyde binding/alpha-tocopherol transport

UniProt Annotations

Entry Information

Gene Name
tocopherol (alpha) transfer protein
Protein Entry
TTPA_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Function Binds alpha-tocopherol, enhances its transfer between separate membranes, and stimulates its release from liver cells. Binds both phosphatidylinol 3,4-bisphosphate and phosphatidylinol 4,5-bisphosphate; the resulting conformation change is important for the release of the bound alpha-tocopherol (By similarity)
Similarity Contains 1 CRAL-TRIO domain. {ECO:0000255|PROSITE- ProRule:PRU00056}.
Subcellular Location Cytoplasm.
Subunit Monomer and homotetramer. Phosphatidylinol 4,5- bisphosphate binding induces the formation of homotetramers. Phosphatidylinol 3,4-bisphosphate is less efficient in inducing tetramerization (By similarity)
Tissue Specificity Liver.

Identical and Related Proteins

Unique RefSeq proteins for LMP012528 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6981682 RefSeq NP_037180 278 alpha-tocopherol transfer protein

Identical Sequences to LMP012528 proteins

Reference Database Accession Length Protein Name
GI:6981682 DBBJ BAA03843.1 278 alpha-tocopherol transfer protein [Rattus norvegicus]
GI:6981682 SwissProt P41034.1 278 RecName: Full=Alpha-tocopherol transfer protein; Short=Alpha-TTP [Rattus norvegicus]

Related Sequences to LMP012528 proteins

Reference Database Accession Length Protein Name
GI:6981682 DBBJ BAA03843.1 278 alpha-tocopherol transfer protein [Rattus norvegicus]
GI:6981682 GenBank EDL98505.1 295 tocopherol (alpha) transfer protein, isoform CRA_b [Rattus norvegicus]
GI:6981682 SwissProt P41034.1 278 RecName: Full=Alpha-tocopherol transfer protein; Short=Alpha-TTP [Rattus norvegicus]