Gene/Proteome Database (LMPD)
LMPD ID
LMP012534
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
homeo box A1
Gene Symbol
Alternate Names
homeobox protein Hox-A1;
Chromosome
4
Map Location
4q24
Summary
sequence specific transcription factor, may regulate positional development along the anterior-posterior axis, may be important for the maintenance and/or development of hindbrain segments [RGD, Feb 2006]
Orthologs
Proteins
homeobox protein Hox-A1 | |
---|---|
Refseq ID | NP_037207 |
Protein GI | 6981040 |
UniProt ID | O08656 |
mRNA ID | NM_013075 |
Length | 333 |
MDNARLNSFLEYPILGSGDSGTCSARVYSSDHGITTFQSCAVSANSCGGDDRFLGGRGVQITSPHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGAQNFSAPYGPYGLNQEADVSGGYPPCAPAVYSGNLSSPMVQHHHHHQGYAGGTVGSPQYIHHSYGQEHQSLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYVGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARSEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPMSPATPPGSDEKTEESSEKSSSSPSAPSPASSTSDTLTTSH |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005634 | IEA:UniProtKB-KW | C | nucleus |
GO:0043565 | IEA:InterPro | F | sequence-specific DNA binding |
GO:0007275 | IEA:UniProtKB-KW | P | multicellular organismal development |
GO:0006355 | IEA:UniProtKB-KW | P | regulation of transcription, DNA-templated |
GO:0006351 | IEA:UniProtKB-KW | P | transcription, DNA-templated |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures. Seems to act in the maintenance and/or generation of hindbrain segments. |
Similarity | Belongs to the Antp homeobox family. Labial subfamily |
Similarity | Contains 1 homeobox DNA-binding domain |
Subcellular Location | Nucleus {ECO:0000255|PROSITE- ProRule:PRU00108}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012534 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
6981040 | RefSeq | NP_037207 | 333 | homeobox protein Hox-A1 |
Identical Sequences to LMP012534 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6981040 | GenBank | AAB51399.1 | 333 | homeobox-plus HoxA1 protein [Rattus norvegicus] |
GI:6981040 | SwissProt | O08656.1 | 333 | RecName: Full=Homeobox protein Hox-A1 [Rattus norvegicus] |
Related Sequences to LMP012534 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6981040 | GenBank | AAB51399.1 | 333 | homeobox-plus HoxA1 protein [Rattus norvegicus] |
GI:6981040 | RefSeq | XP_008773958.1 | 334 | PREDICTED: homeobox protein Hox-A1 isoform X1 [Rattus norvegicus] |
GI:6981040 | SwissProt | O08656.1 | 333 | RecName: Full=Homeobox protein Hox-A1 [Rattus norvegicus] |