Gene/Proteome Database (LMPD)
LMPD ID
LMP012539
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
apolipoprotein A-II
Gene Symbol
Synonyms
APOAII; Apo-AII; ApoA-II;
Alternate Names
apolipoprotein A-II; apolipoprotein A2;
Chromosome
13
Map Location
13q24
Summary
may play a role in lipid metabolism and transport [RGD, Feb 2006]
Orthologs
Proteins
apolipoprotein A-II preproprotein | |
---|---|
Refseq ID | NP_037244 |
Protein GI | 6978517 |
UniProt ID | P04638 |
mRNA ID | NM_013112 |
Length | 102 |
MKLLAMVALLVTICSLEGALVRRQAAETDVQTLFSQYLQSLTDYGKDLMEKAQPSEIQNQAKAYFQNAQERLTPFVQRTGTNLMDFLSRLMSPEEKPAPAAK | |
sig_peptide: 1..18 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1905 peptide sequence: MKLLAMVALLVTICSLEG mat_peptide: 24..102 product: apolipoprotein A-II calculated_mol_wt: 8956 peptide sequence: QAAETDVQTLFSQYLQSLTDYGKDLMEKAQPSEIQNQAKAYFQNAQERLTPFVQRTGTNLMDFLSRLMSPEEKPAPAAK |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0072562 | IEA:Ensembl | C | blood microparticle |
GO:0042627 | IEA:Ensembl | C | chylomicron |
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0034366 | IEA:Ensembl | C | spherical high-density lipoprotein particle |
GO:0034361 | IEA:Ensembl | C | very-low-density lipoprotein particle |
GO:0015485 | IEA:Ensembl | F | cholesterol binding |
GO:0017127 | IDA:RGD | F | cholesterol transporter activity |
GO:0008035 | IEA:Ensembl | F | high-density lipoprotein particle binding |
GO:0055102 | IEA:Ensembl | F | lipase inhibitor activity |
GO:0031210 | IEA:Ensembl | F | phosphatidylcholine binding |
GO:0060228 | IEA:Ensembl | F | phosphatidylcholine-sterol O-acyltransferase activator activity |
GO:0046982 | ISS:UniProtKB | F | protein heterodimerization activity |
GO:0002526 | IEP:RGD | P | acute inflammatory response |
GO:0033344 | IEA:Ensembl | P | cholesterol efflux |
GO:0042632 | IEA:Ensembl | P | cholesterol homeostasis |
GO:0008203 | IEA:Ensembl | P | cholesterol metabolic process |
GO:0030301 | IDA:RGD | P | cholesterol transport |
GO:0046340 | IEA:Ensembl | P | diacylglycerol catabolic process |
GO:0034380 | IEA:Ensembl | P | high-density lipoprotein particle assembly |
GO:0034384 | IEA:Ensembl | P | high-density lipoprotein particle clearance |
GO:0034375 | IEA:Ensembl | P | high-density lipoprotein particle remodeling |
GO:0042157 | IEA:Ensembl | P | lipoprotein metabolic process |
GO:0034374 | IEA:Ensembl | P | low-density lipoprotein particle remodeling |
GO:0060621 | IEA:Ensembl | P | negative regulation of cholesterol import |
GO:0060695 | IEA:Ensembl | P | negative regulation of cholesterol transporter activity |
GO:0002740 | IEA:Ensembl | P | negative regulation of cytokine secretion involved in immune response |
GO:0060192 | IEA:Ensembl | P | negative regulation of lipase activity |
GO:0050995 | IEA:Ensembl | P | negative regulation of lipid catabolic process |
GO:0010903 | IEA:Ensembl | P | negative regulation of very-low-density lipoprotein particle remodeling |
GO:0031100 | IDA:RGD | P | organ regeneration |
GO:0018206 | IEA:Ensembl | P | peptidyl-methionine modification |
GO:0006656 | IEA:Ensembl | P | phosphatidylcholine biosynthetic process |
GO:0009395 | IEA:Ensembl | P | phospholipid catabolic process |
GO:0033700 | IEA:Ensembl | P | phospholipid efflux |
GO:0010873 | IEA:Ensembl | P | positive regulation of cholesterol esterification |
GO:0045416 | ISS:UniProtKB | P | positive regulation of interleukin-8 biosynthetic process |
GO:0050996 | IEA:Ensembl | P | positive regulation of lipid catabolic process |
GO:0006457 | IEA:Ensembl | P | protein folding |
GO:0018158 | IEA:Ensembl | P | protein oxidation |
GO:0030300 | IEA:Ensembl | P | regulation of intestinal cholesterol absorption |
GO:0031647 | IEA:Ensembl | P | regulation of protein stability |
GO:0042493 | IEP:RGD | P | response to drug |
GO:0043627 | IEP:RGD | P | response to estrogen |
GO:0051384 | IEP:RGD | P | response to glucocorticoid |
GO:0009749 | IEA:Ensembl | P | response to glucose |
GO:0043691 | IEA:Ensembl | P | reverse cholesterol transport |
GO:0034370 | IEA:Ensembl | P | triglyceride-rich lipoprotein particle remodeling |
KEGG Pathway Links
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5953879 | Chylomicron-mediated lipid transport |
5953253 | Disease |
5953382 | Diseases associated with visual transduction |
5953288 | Fatty acid, triacylglycerol, and ketone body metabolism |
5953754 | Lipid digestion, mobilization, and transport |
5953836 | Lipoprotein metabolism |
5953250 | Metabolism |
5953289 | Metabolism of lipids and lipoproteins |
5954333 | PPARA activates gene expression |
5954222 | Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha) |
5954392 | Retinoid metabolism and transport |
5953381 | Signal Transduction |
5953380 | Visual phototransduction |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR006801 | Apolipoprotein A-II (ApoA-II) |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism. |
Ptm | Phosphorylation sites are present in the extracellular medium |
Similarity | Belongs to the apolipoprotein A2 family |
Subcellular Location | Secreted. |
Subunit | Monomer. Interacts with APOA1BP and NDRG1 (By similarity) |
Tissue Specificity | Plasma. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012539 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
6978517 | RefSeq | NP_037244 | 102 | apolipoprotein A-II preproprotein |
Identical Sequences to LMP012539 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6978517 | GenBank | EDL94610.1 | 102 | apolipoprotein A-II, isoform CRA_a [Rattus norvegicus] |
GI:6978517 | GenBank | EDL94611.1 | 102 | apolipoprotein A-II, isoform CRA_a [Rattus norvegicus] |
GI:6978517 | RefSeq | XP_006250300.1 | 102 | PREDICTED: apolipoprotein A-II isoform X1 [Rattus norvegicus] |
GI:6978517 | RefSeq | XP_006250301.1 | 102 | PREDICTED: apolipoprotein A-II isoform X1 [Rattus norvegicus] |
Related Sequences to LMP012539 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6978517 | EMBL | CAA27185.1 | 102 | unnamed protein product [Rattus norvegicus] |
GI:6978517 | GenBank | EDL94610.1 | 102 | apolipoprotein A-II, isoform CRA_a [Rattus norvegicus] |
GI:6978517 | GenBank | EDL94611.1 | 102 | apolipoprotein A-II, isoform CRA_a [Rattus norvegicus] |