Gene/Proteome Database (LMPD)

LMPD ID
LMP012539
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
apolipoprotein A-II
Gene Symbol
Synonyms
APOAII; Apo-AII; ApoA-II;
Alternate Names
apolipoprotein A-II; apolipoprotein A2;
Chromosome
13
Map Location
13q24
Summary
may play a role in lipid metabolism and transport [RGD, Feb 2006]
Orthologs

Proteins

apolipoprotein A-II preproprotein
Refseq ID NP_037244
Protein GI 6978517
UniProt ID P04638
mRNA ID NM_013112
Length 102
MKLLAMVALLVTICSLEGALVRRQAAETDVQTLFSQYLQSLTDYGKDLMEKAQPSEIQNQAKAYFQNAQERLTPFVQRTGTNLMDFLSRLMSPEEKPAPAAK
sig_peptide: 1..18 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1905 peptide sequence: MKLLAMVALLVTICSLEG mat_peptide: 24..102 product: apolipoprotein A-II calculated_mol_wt: 8956 peptide sequence: QAAETDVQTLFSQYLQSLTDYGKDLMEKAQPSEIQNQAKAYFQNAQERLTPFVQRTGTNLMDFLSRLMSPEEKPAPAAK

Gene Information

Entrez Gene ID
Gene Name
apolipoprotein A-II
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0072562 IEA:Ensembl C blood microparticle
GO:0042627 IEA:Ensembl C chylomicron
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0034366 IEA:Ensembl C spherical high-density lipoprotein particle
GO:0034361 IEA:Ensembl C very-low-density lipoprotein particle
GO:0015485 IEA:Ensembl F cholesterol binding
GO:0017127 IDA:RGD F cholesterol transporter activity
GO:0008035 IEA:Ensembl F high-density lipoprotein particle binding
GO:0055102 IEA:Ensembl F lipase inhibitor activity
GO:0031210 IEA:Ensembl F phosphatidylcholine binding
GO:0060228 IEA:Ensembl F phosphatidylcholine-sterol O-acyltransferase activator activity
GO:0046982 ISS:UniProtKB F protein heterodimerization activity
GO:0002526 IEP:RGD P acute inflammatory response
GO:0033344 IEA:Ensembl P cholesterol efflux
GO:0042632 IEA:Ensembl P cholesterol homeostasis
GO:0008203 IEA:Ensembl P cholesterol metabolic process
GO:0030301 IDA:RGD P cholesterol transport
GO:0046340 IEA:Ensembl P diacylglycerol catabolic process
GO:0034380 IEA:Ensembl P high-density lipoprotein particle assembly
GO:0034384 IEA:Ensembl P high-density lipoprotein particle clearance
GO:0034375 IEA:Ensembl P high-density lipoprotein particle remodeling
GO:0042157 IEA:Ensembl P lipoprotein metabolic process
GO:0034374 IEA:Ensembl P low-density lipoprotein particle remodeling
GO:0060621 IEA:Ensembl P negative regulation of cholesterol import
GO:0060695 IEA:Ensembl P negative regulation of cholesterol transporter activity
GO:0002740 IEA:Ensembl P negative regulation of cytokine secretion involved in immune response
GO:0060192 IEA:Ensembl P negative regulation of lipase activity
GO:0050995 IEA:Ensembl P negative regulation of lipid catabolic process
GO:0010903 IEA:Ensembl P negative regulation of very-low-density lipoprotein particle remodeling
GO:0031100 IDA:RGD P organ regeneration
GO:0018206 IEA:Ensembl P peptidyl-methionine modification
GO:0006656 IEA:Ensembl P phosphatidylcholine biosynthetic process
GO:0009395 IEA:Ensembl P phospholipid catabolic process
GO:0033700 IEA:Ensembl P phospholipid efflux
GO:0010873 IEA:Ensembl P positive regulation of cholesterol esterification
GO:0045416 ISS:UniProtKB P positive regulation of interleukin-8 biosynthetic process
GO:0050996 IEA:Ensembl P positive regulation of lipid catabolic process
GO:0006457 IEA:Ensembl P protein folding
GO:0018158 IEA:Ensembl P protein oxidation
GO:0030300 IEA:Ensembl P regulation of intestinal cholesterol absorption
GO:0031647 IEA:Ensembl P regulation of protein stability
GO:0042493 IEP:RGD P response to drug
GO:0043627 IEP:RGD P response to estrogen
GO:0051384 IEP:RGD P response to glucocorticoid
GO:0009749 IEA:Ensembl P response to glucose
GO:0043691 IEA:Ensembl P reverse cholesterol transport
GO:0034370 IEA:Ensembl P triglyceride-rich lipoprotein particle remodeling

KEGG Pathway Links

KEGG Pathway ID Description
ko03320 PPAR signaling pathway
rno03320 PPAR signaling pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
5953879 Chylomicron-mediated lipid transport
5953253 Disease
5953382 Diseases associated with visual transduction
5953288 Fatty acid, triacylglycerol, and ketone body metabolism
5953754 Lipid digestion, mobilization, and transport
5953836 Lipoprotein metabolism
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5954333 PPARA activates gene expression
5954222 Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha)
5954392 Retinoid metabolism and transport
5953381 Signal Transduction
5953380 Visual phototransduction

Domain Information

InterPro Annotations

Accession Description
IPR006801 Apolipoprotein A-II (ApoA-II)

UniProt Annotations

Entry Information

Gene Name
apolipoprotein A-II
Protein Entry
APOA2_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Function May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism.
Ptm Phosphorylation sites are present in the extracellular medium
Similarity Belongs to the apolipoprotein A2 family
Subcellular Location Secreted.
Subunit Monomer. Interacts with APOA1BP and NDRG1 (By similarity)
Tissue Specificity Plasma.

Identical and Related Proteins

Unique RefSeq proteins for LMP012539 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6978517 RefSeq NP_037244 102 apolipoprotein A-II preproprotein

Identical Sequences to LMP012539 proteins

Reference Database Accession Length Protein Name
GI:6978517 GenBank EDL94610.1 102 apolipoprotein A-II, isoform CRA_a [Rattus norvegicus]
GI:6978517 GenBank EDL94611.1 102 apolipoprotein A-II, isoform CRA_a [Rattus norvegicus]
GI:6978517 RefSeq XP_006250300.1 102 PREDICTED: apolipoprotein A-II isoform X1 [Rattus norvegicus]
GI:6978517 RefSeq XP_006250301.1 102 PREDICTED: apolipoprotein A-II isoform X1 [Rattus norvegicus]

Related Sequences to LMP012539 proteins

Reference Database Accession Length Protein Name
GI:6978517 EMBL CAA27185.1 102 unnamed protein product [Rattus norvegicus]
GI:6978517 GenBank EDL94610.1 102 apolipoprotein A-II, isoform CRA_a [Rattus norvegicus]
GI:6978517 GenBank EDL94611.1 102 apolipoprotein A-II, isoform CRA_a [Rattus norvegicus]