Gene/Proteome Database (LMPD)

LMPD ID
LMP012551
Gene ID
25706
Species
Rattus norvegicus (Rat)
Gene Name
cholecystokinin B receptor
Gene Symbol
Cckbr
Synonyms
Cck2r; Cholrec;
Alternate Names
gastrin/cholecystokinin type B receptor; CCK-BR; CCK2-R; CCK2 receptor; CCK-B receptor; CCK(B) receptor; cholecystokinin-2 receptor;
Chromosome
1
Map Location
1q33
Summary
Cholecystokinin was one of the first gastrointestinal peptides discovered in the mammalian brain. Cholecystokinin receptors are members of the G protein-coupled receptor superfamily, stimulating phosphatidylinositol turnover and intracellular calcium mobilization. This gene encodes a cholecystokinin receptor of the B subtype. These receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for Cckbr

Proteins

gastrin/cholecystokinin type B receptor
Refseq ID NP_037297
Protein GI 6978617
UniProt ID P30553
mRNA ID NM_013165
Length 452
MELLKLNRSVQGPGPGSGSSLCRPGVSLLNSSSAGNLSCDPPRIRGTGTRELEMAIRITLYAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAISYLMGVSVSVSTLNLVAIALERYSAICRPLQARVWQTRSHAARVILATWLLSGLLMVPYPVYTMVQPVGPRVLQCMHRWPSARVQQTWSVLLLLLLFFIPGVVIAVAYGLISRELYLGLHFDGENDSETQSRARNQGGLPGGAAPGPVHQNGGCRPVTSVAGEDSDGCCVQLPRSRLEMTTLTTPTPGPVPGPRPNQAKLLAKKRVVRMLLVIVLLFFLCWLPVYSVNTWRAFDGPGAQRALSGAPISFIHLLSYVSACVNPLVYCFMHRRFRQACLDTCARCCPRPPRARPQPLPDEDPPTPSIASLSRLSYTTISTLGPG

Gene Information

Entrez Gene ID
25706
Gene Name
cholecystokinin B receptor
Gene Symbol
Cckbr
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:RGD C cytoplasm
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005634 IDA:RGD C nucleus
GO:0005886 IDA:RGD C plasma membrane
GO:0015054 ISS:UniProtKB F gastrin receptor activity
GO:0070371 IMP:RGD P ERK1 and ERK2 cascade
GO:0006915 IMP:RGD P apoptotic process
GO:0002209 IMP:RGD P behavioral defense response
GO:0007586 IEP:RGD P digestion
GO:0060206 IDA:RGD P estrous cycle phase
GO:0001821 IMP:RGD P histamine secretion
GO:0008284 ISS:UniProtKB P positive regulation of cell proliferation
GO:0007204 ISS:UniProtKB P positive regulation of cytosolic calcium ion concentration
GO:0090274 IMP:RGD P positive regulation of somatostatin secretion
GO:0050806 IMP:RGD P positive regulation of synaptic transmission
GO:0032230 IMP:RGD P positive regulation of synaptic transmission, GABAergic
GO:0051968 IMP:RGD P positive regulation of synaptic transmission, glutamatergic
GO:0051930 IMP:RGD P regulation of sensory perception of pain
GO:0032868 IEP:RGD P response to insulin

KEGG Pathway Links

KEGG Pathway ID Description
ko04020 Calcium signaling pathway
rno04020 Calcium signaling pathway
ko04971 Gastric acid secretion
rno04971 Gastric acid secretion
ko04080 Neuroactive ligand-receptor interaction
rno04080 Neuroactive ligand-receptor interaction

Domain Information

InterPro Annotations

Accession Description
IPR009126 Cholecystokinin receptor
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM
IPR000314 Gastrin receptor

UniProt Annotations

Entry Information

Gene Name
cholecystokinin B receptor
Protein Entry
GASR_RAT
UniProt ID
P30553
Species
Rat

Comments

Comment Type Description
Function Receptor for gastrin and cholecystokinin. The CKK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Similarity Belongs to the G-protein coupled receptor 1 family
Subcellular Location Cell membrane; Multi-pass membrane protein.
Tissue Specificity Parietal cells, pancreas, brain and various neoplastic tissues.

Identical and Related Proteins

Unique RefSeq proteins for LMP012551 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6978617 RefSeq NP_037297 452 gastrin/cholecystokinin type B receptor

Identical Sequences to LMP012551 proteins

Reference Database Accession Length Protein Name
GI:6978617 GenBank AAA40925.1 452 cholecystokinin receptor [Rattus norvegicus]
GI:6978617 GenBank AAE56967.1 452 Sequence 16 from patent US 6169173
GI:6978617 GenBank AAT21515.1 452 Sequence 16 from patent US 6706493
GI:6978617 SwissProt P30553.1 452 RecName: Full=Gastrin/cholecystokinin type B receptor; Short=CCK-B receptor; Short=CCK-BR; AltName: Full=Cholecystokinin-2 receptor; Short=CCK2-R [Rattus norvegicus]

Related Sequences to LMP012551 proteins

Reference Database Accession Length Protein Name
GI:6978617 GenBank AAA40925.1 452 cholecystokinin receptor [Rattus norvegicus]
GI:6978617 GenBank AAE56967.1 452 Sequence 16 from patent US 6169173
GI:6978617 SwissProt P30553.1 452 RecName: Full=Gastrin/cholecystokinin type B receptor; Short=CCK-B receptor; Short=CCK-BR; AltName: Full=Cholecystokinin-2 receptor; Short=CCK2-R [Rattus norvegicus]