Gene/Proteome Database (LMPD)
LMPD ID
LMP012552
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
synaptotagmin I
Gene Symbol
Synonyms
P65;
Alternate Names
synaptotagmin-1; sytI; synaptotagmin 1;
Chromosome
7
Map Location
7q21
Summary
integral component of synaptic vesicle membranes; important for exocytosis and vesicle trafficking to the active zone of synapses; may be the calcium sensor for calcium-dependent exocytosis [RGD, Feb 2006]
Orthologs
Proteins
synaptotagmin-1 | |
---|---|
Refseq ID | NP_001028852 |
Protein GI | 148356226 |
UniProt ID | Q707P0 |
mRNA ID | NM_001033680 |
Length | 421 |
MVSASHPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWALIAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0043005 | IEA:Ensembl | C | neuron projection |
GO:0042734 | IEA:Ensembl | C | presynaptic membrane |
GO:0030141 | IEA:Ensembl | C | secretory granule |
GO:0030672 | IEA:Ensembl | C | synaptic vesicle membrane |
GO:0005509 | IEA:Ensembl | F | calcium ion binding |
GO:0016079 | IEA:Ensembl | P | synaptic vesicle exocytosis |
KEGG Pathway Links
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5954090 | Acetylcholine Neurotransmitter Release Cycle |
5954111 | GABA synthesis, release, reuptake and degradation |
5953278 | Glutamate Neurotransmitter Release Cycle |
5953277 | Neuronal System |
5953279 | Neurotransmitter Release Cycle |
5954116 | Norepinephrine Neurotransmitter Release Cycle |
5953276 | Transmission across Chemical Synapses |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR015428 | Synaptotagmin 1 |
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP012552 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
148356226 | RefSeq | NP_001028852 | 421 | synaptotagmin-1 |
Identical Sequences to LMP012552 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:148356226 | EMBL | CAE85101.1 | 421 | synaptotagmin 1 [Rattus rattus] |
GI:148356226 | GenBank | ABA00482.1 | 421 | synaptotagmin I [Rattus norvegicus] |
GI:148356226 | SwissProt | P21707.3 | 421 | RecName: Full=Synaptotagmin-1; AltName: Full=Synaptotagmin I; Short=SytI; AltName: Full=p65 [Rattus norvegicus] |
Related Sequences to LMP012552 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:148356226 | EMBL | CAE85101.1 | 421 | synaptotagmin 1 [Rattus rattus] |
GI:148356226 | GenBank | ABA00482.1 | 421 | synaptotagmin I [Rattus norvegicus] |
GI:148356226 | SwissProt | P21707.3 | 421 | RecName: Full=Synaptotagmin-1; AltName: Full=Synaptotagmin I; Short=SytI; AltName: Full=p65 [Rattus norvegicus] |