Gene/Proteome Database (LMPD)
LMPD ID
LMP012567
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
sialidase 2
Gene Symbol
Alternate Names
sialidase-2; neuraminidase 2; cytosolic sialidase; N-acetyl-alpha-neuraminidase 2;
Chromosome
9
Map Location
9q36
Summary
cytosolic enzyme that cleaves sialic acid; involved in the degradation of glycolipids and glycoproteins [RGD, Feb 2006]
Orthologs
Proteins
sialidase-2 | |
---|---|
Refseq ID | NP_058826 |
Protein GI | 126723022 |
UniProt ID | Q5BK97 |
mRNA ID | NM_017130 |
Length | 379 |
METCPVLQKETLFHTEVYAYRIPALLYLKKQKTLLAFAEKRASRTDEHAELIVLRRGSYNGATNHVKWQPEEVVTQAQLEGHRSMNPCPLYDKQTKTLFLFFIAVPGRVSEQHQLQTRVNVTRLCRVTSTDYGMNWSPVQDLTETTIGSTHQDWATFAVGPGHCLQLRNRAGSLLVPAYAYQKLHPVHKPTPFAFCFISLDHGHTWELGNFVSENSLECQVAEVGTGAHRVVYLNARSFIGARVQAQSPNDGLDFQDNQVVSKLVEPPHGCHGSVVAFHSPTSKPDALDMWLLYTHPTDSRNRTNLGVYLNQTPLDPTAWSEPTLLATGTCAYSDLQNMGRGPDGSPQFGCLYESGNYDEIIFLMFTLKQAFPTVHGAQ |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0052794 | IEA:Ensembl | F | exo-alpha-(2->3)-sialidase activity |
GO:0006689 | IEA:Ensembl | P | ganglioside catabolic process |
GO:0009313 | IEA:Ensembl | P | oligosaccharide catabolic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00511 | Other glycan degradation |
rno00511 | Other glycan degradation |
ko00600 | Sphingolipid metabolism |
rno00600 | Sphingolipid metabolism |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5953739 | Asparagine N-linked glycosylation |
5953738 | Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein |
5954485 | Glycosphingolipid metabolism |
5953250 | Metabolism |
5953289 | Metabolism of lipids and lipoproteins |
5953345 | Metabolism of proteins |
5953728 | Post-translational protein modification |
5954270 | Sialic acid metabolism |
5954267 | Sphingolipid metabolism |
5953737 | Synthesis of substrates in N-glycan biosythesis |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP012567 (as displayed in Record Overview)
Identical Sequences to LMP012567 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:126723022 | RefSeq | XP_006245427.1 | 379 | PREDICTED: sialidase-2 isoform X1 [Rattus norvegicus] |
GI:126723022 | RefSeq | XP_008765431.1 | 379 | PREDICTED: sialidase-2 isoform X1 [Rattus norvegicus] |
GI:126723022 | RefSeq | XP_008765432.1 | 379 | PREDICTED: sialidase-2 isoform X1 [Rattus norvegicus] |
GI:126723022 | RefSeq | XP_008765433.1 | 379 | PREDICTED: sialidase-2 isoform X1 [Rattus norvegicus] |
Related Sequences to LMP012567 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:126723022 | RefSeq | XP_008765431.1 | 379 | PREDICTED: sialidase-2 isoform X1 [Rattus norvegicus] |
GI:126723022 | RefSeq | XP_008765432.1 | 379 | PREDICTED: sialidase-2 isoform X1 [Rattus norvegicus] |
GI:126723022 | RefSeq | XP_008765433.1 | 379 | PREDICTED: sialidase-2 isoform X1 [Rattus norvegicus] |