Gene/Proteome Database (LMPD)
LMPD ID
LMP012583
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
phospholipase A2, group V
Gene Symbol
Alternate Names
calcium-dependent phospholipase A2; PLA2-10; group V phospholipase A2; phospholipase A2, group 5; phosphatidylcholine 2-acylhydrolase 5;
Chromosome
5
Map Location
5q36
EC Number
3.1.1.4
Summary
catalyzes calcium ion dependent hydrolysis of phospholipids [RGD, Feb 2006]
Orthologs
Proteins
| calcium-dependent phospholipase A2 precursor | |
|---|---|
| Refseq ID | NP_058870 |
| Protein GI | 8393974 |
| UniProt ID | P51433 |
| mRNA ID | NM_017174 |
| Length | 137 |
| MKRLLTLAWFLACSVPAVPGGLLELKSMIEKVTGKNAVKNYGFYGCYCGWGGHGTPKDGTDWCCRMHDRCYGLLEEKHCAIRTQSYDYRFTQDLVICEHDSFCPVRLCACDRKLVYCLRRNLWSYNRLYQYYPNFLC | |
| sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2174 peptide sequence: MKRLLTLAWFLACSVPAVPG mat_peptide: 21..137 product: Calcium-dependent phospholipase A2 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P51433.1) calculated_mol_wt: 13840 peptide sequence: GLLELKSMIEKVTGKNAVKNYGFYGCYCGWGGHGTPKDGTDWCCRMHDRCYGLLEEKHCAIRTQSYDYRFTQDLVICEHDSFCPVRLCACDRKLVYCLRRNLWSYNRLYQYYPNFLC | |
Gene Information
Entrez Gene ID
Gene Name
phospholipase A2, group V
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IDA:RGD | C | Golgi apparatus |
| GO:0009986 | IEA:Ensembl | C | cell surface |
| GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
| GO:0048471 | IDA:RGD | C | perinuclear region of cytoplasm |
| GO:0005886 | IDA:RGD | C | plasma membrane |
| GO:0005509 | IEA:InterPro | F | calcium ion binding |
| GO:0047498 | IDA:RGD | F | calcium-dependent phospholipase A2 activity |
| GO:0008201 | IDA:RGD | F | heparin binding |
| GO:0050482 | IDA:RGD | P | arachidonic acid secretion |
| GO:0019370 | IDA:RGD | P | leukotriene biosynthetic process |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
| GO:0006663 | IDA:RGD | P | platelet activating factor biosynthetic process |
| GO:0051591 | IEP:RGD | P | response to cAMP |
| GO:0034097 | IEP:RGD | P | response to cytokine |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00590 | Arachidonic acid metabolism |
| rno00590 | Arachidonic acid metabolism |
| ko00565 | Ether lipid metabolism |
| rno00565 | Ether lipid metabolism |
| ko04975 | Fat digestion and absorption |
| rno04975 | Fat digestion and absorption |
| ko00564 | Glycerophospholipid metabolism |
| rno00564 | Glycerophospholipid metabolism |
| ko00591 | Linoleic acid metabolism |
| rno00591 | Linoleic acid metabolism |
| rno01100 | Metabolic pathways |
| ko04972 | Pancreatic secretion |
| rno04972 | Pancreatic secretion |
| rno04014 | Ras signaling pathway |
| ko04270 | Vascular smooth muscle contraction |
| rno04270 | Vascular smooth muscle contraction |
| ko00592 | alpha-Linolenic acid metabolism |
| rno00592 | alpha-Linolenic acid metabolism |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5954464 | Acyl chain remodelling of PC |
| 5954471 | Acyl chain remodelling of PE |
| 5954465 | Acyl chain remodelling of PG |
| 5954468 | Acyl chain remodelling of PI |
| 5954470 | Acyl chain remodelling of PS |
| 5953473 | Glycerophospholipid biosynthesis |
| 5953250 | Metabolism |
| 5953289 | Metabolism of lipids and lipoproteins |
| 5953474 | Phospholipid metabolism |
| 5953472 | Synthesis of PA |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate. {ECO:0000255|PROSITE- ProRule:PRU10035, ECO:0000255|PROSITE-ProRule:PRU10036}. |
| Cofactor | Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence= ; Note=Binds 1 Ca(2+) ion per subunit. ; |
| Function | PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes L- alpha-palmitoyl-2-oleoyl phosphatidylcholine more efficiently than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1- palmitoyl-2-arachidonyl phosphatidylethanolamine or L-alpha-1- stearoyl-2-arachidonyl phosphatidylinositol. |
| Ptm | This enzyme lacks one of the seven disulfide bonds found in similar PA2 proteins. |
| Similarity | Belongs to the phospholipase A2 family |
| Subcellular Location | Secreted. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012583 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 8393974 | RefSeq | NP_058870 | 137 | calcium-dependent phospholipase A2 precursor |
Identical Sequences to LMP012583 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:8393974 | RefSeq | XP_006239202.1 | 137 | PREDICTED: calcium-dependent phospholipase A2 isoform X1 [Rattus norvegicus] |
| GI:8393974 | RefSeq | XP_006239203.1 | 137 | PREDICTED: calcium-dependent phospholipase A2 isoform X1 [Rattus norvegicus] |
| GI:8393974 | RefSeq | XP_008762431.1 | 137 | PREDICTED: calcium-dependent phospholipase A2 isoform X1 [Rattus norvegicus] |
| GI:8393974 | RefSeq | XP_008762432.1 | 137 | PREDICTED: calcium-dependent phospholipase A2 isoform X1 [Rattus norvegicus] |
Related Sequences to LMP012583 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:8393974 | GenBank | EDL80888.1 | 137 | phospholipase A2, group V, isoform CRA_a [Rattus norvegicus] |
| GI:8393974 | RefSeq | XP_008762431.1 | 137 | PREDICTED: calcium-dependent phospholipase A2 isoform X1 [Rattus norvegicus] |
| GI:8393974 | RefSeq | XP_008762432.1 | 137 | PREDICTED: calcium-dependent phospholipase A2 isoform X1 [Rattus norvegicus] |