Gene/Proteome Database (LMPD)

LMPD ID
LMP012589
Gene ID
29411
Species
Rattus norvegicus (Rat)
Gene Name
palmitoyl-protein thioesterase 1
Gene Symbol
Ppt1
Synonyms
Ppt;
Alternate Names
palmitoyl-protein thioesterase 1; PPT-1; palmitoyl-protein hydrolase 1;
Chromosome
5
Map Location
5q36
EC Number
3.1.2.22
Summary
deficiency causes drastic neurodegeneration; may protect neurons from excitotoxicity; may mediate synaptic plasticity [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Ppt1

Proteins

palmitoyl-protein thioesterase 1 precursor
Refseq ID NP_071947
Protein GI 11968070
UniProt ID P45479
mRNA ID NM_022502
Length 306
MASPGYRRLLAAALLPWCCAAWALGHLDPPSPPPLVIWHGMGDSCCNPMSMGSIKKMVEKEIPGIYVLSLEIGKNMVEDVENSFFLNVNLQVGMACQILEKDPKLQHGYNAIGFSQGGQFLRAVAQRCPTPPMMTLISVGGQHQGVFGLPRCPGESSHICDFIRKSLNAGAYSKVVQERLVQAQYWHDPIKEEVYRNCSIFLADINQERHINESYKENLMALKKFVMVKFFNDSIVDPVDSEWFGFYRSGQAKETIPLQETTLYTEDRLGLKKMDKAGKLVFLAKEGDHLQISKEWFTAHIIPFLK
sig_peptide: 1..27 inference: non-experimental evidence, no additional details recorded note: By similarity; propagated from UniProtKB/Swiss-Prot (P45479.1) calculated_mol_wt: 2913 peptide sequence: MASPGYRRLLAAALLPWCCAAWALGHL mat_peptide: 28..306 product: Palmitoyl-protein thioesterase 1 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P45479.1) calculated_mol_wt: 31561 peptide sequence: DPPSPPPLVIWHGMGDSCCNPMSMGSIKKMVEKEIPGIYVLSLEIGKNMVEDVENSFFLNVNLQVGMACQILEKDPKLQHGYNAIGFSQGGQFLRAVAQRCPTPPMMTLISVGGQHQGVFGLPRCPGESSHICDFIRKSLNAGAYSKVVQERLVQAQYWHDPIKEEVYRNCSIFLADINQERHINESYKENLMALKKFVMVKFFNDSIVDPVDSEWFGFYRSGQAKETIPLQETTLYTEDRLGLKKMDKAGKLVFLAKEGDHLQISKEWFTAHIIPFLK

Gene Information

Entrez Gene ID
29411
Gene Name
palmitoyl-protein thioesterase 1
Gene Symbol
Ppt1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 ISS:UniProtKB C Golgi apparatus
GO:0030424 ISS:UniProtKB C axon
GO:0005829 ISS:UniProtKB C cytosol
GO:0030425 IEA:Ensembl C dendrite
GO:0005576 ISS:UniProtKB C extracellular region
GO:0005615 IEA:Ensembl C extracellular space
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005764 ISS:UniProtKB C lysosome
GO:0045121 ISS:UniProtKB C membrane raft
GO:0043005 IDA:RGD C neuron projection
GO:0043025 IDA:RGD C neuronal cell body
GO:0005634 ISS:UniProtKB C nucleus
GO:0045202 IDA:RGD C synapse
GO:0008021 ISS:UniProtKB C synaptic vesicle
GO:0008474 ISS:UniProtKB F palmitoyl-(protein) hydrolase activity
GO:0016290 ISS:UniProtKB F palmitoyl-CoA hydrolase activity
GO:0008344 IEA:Ensembl P adult locomotory behavior
GO:0006309 IEA:Ensembl P apoptotic DNA fragmentation
GO:0008306 IEA:Ensembl P associative learning
GO:0007420 ISS:UniProtKB P brain development
GO:0044257 IEA:Ensembl P cellular protein catabolic process
GO:0051186 ISS:UniProtKB P cofactor metabolic process
GO:0051181 ISS:UniProtKB P cofactor transport
GO:0007625 IEA:Ensembl P grooming behavior
GO:0016042 ISS:UniProtKB P lipid catabolic process
GO:0007042 ISS:UniProtKB P lysosomal lumen acidification
GO:0031579 ISS:UniProtKB P membrane raft organization
GO:0043066 ISS:UniProtKB P negative regulation of apoptotic process
GO:0030308 ISS:UniProtKB P negative regulation of cell growth
GO:0043524 ISS:UniProtKB P negative regulation of neuron apoptotic process
GO:0007399 ISS:UniProtKB P nervous system development
GO:0007269 IEA:Ensembl P neurotransmitter secretion
GO:0006907 IEA:Ensembl P pinocytosis
GO:0048549 ISS:UniProtKB P positive regulation of pinocytosis
GO:0048260 ISS:UniProtKB P positive regulation of receptor-mediated endocytosis
GO:0002084 ISS:UniProtKB P protein depalmitoylation
GO:0015031 ISS:UniProtKB P protein transport
GO:0006898 IBA:RefGenome P receptor-mediated endocytosis
GO:0032429 IEA:Ensembl P regulation of phospholipase A2 activity
GO:0048167 TAS:RGD P regulation of synaptic plasticity
GO:0007268 IBA:RefGenome P synaptic transmission
GO:0007601 IEA:Ensembl P visual perception

KEGG Pathway Links

KEGG Pathway ID Description
ko00062 Fatty acid elongation
rno00062 Fatty acid elongation
ko01212 Fatty acid metabolism
rno01212 Fatty acid metabolism
ko04142 Lysosome
rno04142 Lysosome
rno01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR029058 Alpha/Beta hydrolase fold
IPR002472 Palmitoyl protein thioesterase

UniProt Annotations

Entry Information

Gene Name
palmitoyl-protein thioesterase 1
Protein Entry
PPT1_RAT
UniProt ID
P45479
Species
Rat

Comments

Comment Type Description
Catalytic Activity Palmitoyl-[protein] + H(2)O = palmitate + [protein].
Function Removes thioester-linked fatty acyl groups such as palmitate from modified cysteine residues in proteins or peptides during lysosomal degradation. Prefers acyl chain lengths of 14 to 18 carbons.
Similarity Belongs to the palmitoyl-protein thioesterase family
Subcellular Location Lysosome.
Tissue Specificity Highest amounts in brain, testis, lung, and spleen. Lowest amounts in liver and skeletal muscle.

Identical and Related Proteins

Unique RefSeq proteins for LMP012589 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
11968070 RefSeq NP_071947 306 palmitoyl-protein thioesterase 1 precursor

Identical Sequences to LMP012589 proteins

Reference Database Accession Length Protein Name
GI:11968070 GenBank AAI26090.1 306 Palmitoyl-protein thioesterase 1 [Rattus norvegicus]
GI:11968070 GenBank EDL80359.1 306 palmitoyl-protein thioesterase 1, isoform CRA_a [Rattus norvegicus]
GI:11968070 GenBank EDL80360.1 306 palmitoyl-protein thioesterase 1, isoform CRA_a [Rattus norvegicus]
GI:11968070 SwissProt P45479.1 306 RecName: Full=Palmitoyl-protein thioesterase 1; Short=PPT-1; AltName: Full=Palmitoyl-protein hydrolase 1; Flags: Precursor [Rattus norvegicus]

Related Sequences to LMP012589 proteins

Reference Database Accession Length Protein Name
GI:11968070 GenBank AAA59358.1 306 palmitoyl-protein thioesterase [Rattus norvegicus]
GI:11968070 GenBank AAI26090.1 306 Palmitoyl-protein thioesterase 1 [Rattus norvegicus]
GI:11968070 SwissProt P45479.1 306 RecName: Full=Palmitoyl-protein thioesterase 1; Short=PPT-1; AltName: Full=Palmitoyl-protein hydrolase 1; Flags: Precursor [Rattus norvegicus]