Gene/Proteome Database (LMPD)
LMPD ID
LMP012600
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
phosphatidylcholine transfer protein
Gene Symbol
Alternate Names
phosphatidylcholine transfer protein; PC-TP; stARD2; START domain-containing protein 2; stAR-related lipid transfer protein 2;
Chromosome
10
Map Location
10q26
Summary
plays a role in intermembrane transfer of phosphatidylcholines [RGD, Feb 2006]
Orthologs
Proteins
phosphatidylcholine transfer protein | |
---|---|
Refseq ID | NP_058921 |
Protein GI | 8393922 |
UniProt ID | P53809 |
mRNA ID | NM_017225 |
Length | 214 |
MAGPAAHFSDEQFREACAELQKPALTGADWQLLVEASGITIYRLLDQSTGLYEYKVFGVLESCIPSLLADVYMDLDYRKKWDQYVKELYEKSFDGQMVAYWEVKYPFPLSNRDYVYTRQRRDLDVDGRKIYVVLAQNISVPQFPEKSGVIRVKQYKQSLAIESDGKKGSRVFMYYFDNPGGQIPSWLINWAAKNGVPSFLKDMVKACQNYHKKT |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylcholine transfer protein
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005829 | TAS:RGD | C | cytosol |
GO:0031210 | ISS:UniProtKB | F | phosphatidylcholine binding |
GO:0008525 | ISS:UniProtKB | F | phosphatidylcholine transporter activity |
GO:0008203 | IEA:Ensembl | P | cholesterol metabolic process |
GO:0015914 | ISS:UniProtKB | P | phospholipid transport |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Lipid transfer protein that promotes intermembrane transfer of phosphatidylcholines but no other phospholipids. Binds a single lipid molecule. May play a role in hepatocellular selection and transport of phosphatidylcholines during bile formation. |
Similarity | Contains 1 START domain. {ECO:0000255|PROSITE- ProRule:PRU00197}. |
Subcellular Location | Cytoplasm. |
Subunit | Interacts with ACOT13/THEM2 |
Identical and Related Proteins
Unique RefSeq proteins for LMP012600 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
8393922 | RefSeq | NP_058921 | 214 | phosphatidylcholine transfer protein |
Identical Sequences to LMP012600 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:8393922 | GenBank | AAC98930.1 | 214 | phosphatidylcholine transfer protein [Rattus norvegicus] |
GI:8393922 | GenBank | AAH78854.1 | 214 | Phosphatidylcholine transfer protein [Rattus norvegicus] |
GI:8393922 | GenBank | EDM05663.1 | 214 | phosphatidylcholine transfer protein, isoform CRA_a [Rattus norvegicus] |
GI:8393922 | SwissProt | P53809.2 | 214 | RecName: Full=Phosphatidylcholine transfer protein; Short=PC-TP; AltName: Full=START domain-containing protein 2; Short=StARD2; AltName: Full=StAR-related lipid transfer protein 2 [Rattus norvegicus] |
Related Sequences to LMP012600 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:8393922 | GenBank | AAH78854.1 | 214 | Phosphatidylcholine transfer protein [Rattus norvegicus] |
GI:8393922 | GenBank | EDM05663.1 | 214 | phosphatidylcholine transfer protein, isoform CRA_a [Rattus norvegicus] |
GI:8393922 | SwissProt | P53809.2 | 214 | RecName: Full=Phosphatidylcholine transfer protein; Short=PC-TP; AltName: Full=START domain-containing protein 2; Short=StARD2; AltName: Full=StAR-related lipid transfer protein 2 [Rattus norvegicus] |