Gene/Proteome Database (LMPD)

LMPD ID
LMP012600
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
phosphatidylcholine transfer protein
Gene Symbol
Alternate Names
phosphatidylcholine transfer protein; PC-TP; stARD2; START domain-containing protein 2; stAR-related lipid transfer protein 2;
Chromosome
10
Map Location
10q26
Summary
plays a role in intermembrane transfer of phosphatidylcholines [RGD, Feb 2006]
Orthologs

Proteins

phosphatidylcholine transfer protein
Refseq ID NP_058921
Protein GI 8393922
UniProt ID P53809
mRNA ID NM_017225
Length 214
MAGPAAHFSDEQFREACAELQKPALTGADWQLLVEASGITIYRLLDQSTGLYEYKVFGVLESCIPSLLADVYMDLDYRKKWDQYVKELYEKSFDGQMVAYWEVKYPFPLSNRDYVYTRQRRDLDVDGRKIYVVLAQNISVPQFPEKSGVIRVKQYKQSLAIESDGKKGSRVFMYYFDNPGGQIPSWLINWAAKNGVPSFLKDMVKACQNYHKKT

Gene Information

Entrez Gene ID
Gene Name
phosphatidylcholine transfer protein
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 TAS:RGD C cytosol
GO:0031210 ISS:UniProtKB F phosphatidylcholine binding
GO:0008525 ISS:UniProtKB F phosphatidylcholine transporter activity
GO:0008203 IEA:Ensembl P cholesterol metabolic process
GO:0015914 ISS:UniProtKB P phospholipid transport

Domain Information

InterPro Annotations

Accession Description
IPR023393 START-like domain
IPR002913 START_lipid-bd_dom

UniProt Annotations

Entry Information

Gene Name
phosphatidylcholine transfer protein
Protein Entry
PPCT_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Function Lipid transfer protein that promotes intermembrane transfer of phosphatidylcholines but no other phospholipids. Binds a single lipid molecule. May play a role in hepatocellular selection and transport of phosphatidylcholines during bile formation.
Similarity Contains 1 START domain. {ECO:0000255|PROSITE- ProRule:PRU00197}.
Subcellular Location Cytoplasm.
Subunit Interacts with ACOT13/THEM2

Identical and Related Proteins

Unique RefSeq proteins for LMP012600 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
8393922 RefSeq NP_058921 214 phosphatidylcholine transfer protein

Identical Sequences to LMP012600 proteins

Reference Database Accession Length Protein Name
GI:8393922 GenBank AAC98930.1 214 phosphatidylcholine transfer protein [Rattus norvegicus]
GI:8393922 GenBank AAH78854.1 214 Phosphatidylcholine transfer protein [Rattus norvegicus]
GI:8393922 GenBank EDM05663.1 214 phosphatidylcholine transfer protein, isoform CRA_a [Rattus norvegicus]
GI:8393922 SwissProt P53809.2 214 RecName: Full=Phosphatidylcholine transfer protein; Short=PC-TP; AltName: Full=START domain-containing protein 2; Short=StARD2; AltName: Full=StAR-related lipid transfer protein 2 [Rattus norvegicus]

Related Sequences to LMP012600 proteins

Reference Database Accession Length Protein Name
GI:8393922 GenBank AAH78854.1 214 Phosphatidylcholine transfer protein [Rattus norvegicus]
GI:8393922 GenBank EDM05663.1 214 phosphatidylcholine transfer protein, isoform CRA_a [Rattus norvegicus]
GI:8393922 SwissProt P53809.2 214 RecName: Full=Phosphatidylcholine transfer protein; Short=PC-TP; AltName: Full=START domain-containing protein 2; Short=StARD2; AltName: Full=StAR-related lipid transfer protein 2 [Rattus norvegicus]